KEGG   Saccharomyces cerevisiae (budding yeast): YHL009W-AHelp
Entry
YHL009W-A         CDS       T00005                                 

Definition
gag protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VIII:85909..87150
Genome map
AA seq 413 aa AA seqDB search
MATPVRDETRNVIDDNISARIQSKVKTNDTVRQTPSSLRKVSIKDEQVKQYQRNLNRFKT
ILNGLKAEEEKLSETDDIQMLAEKLLKLGETIDKVENRIVDLVEKIQLLETNENNNILHE
HIDATGTYYLFDTLTSTNKRFYPKDCVFDYRTNNVENIPILLNNFKKFIKKYQFDDVFEN
DIIEIDPRENEILCKIIKEGLGESLDIMNTNTTDIFRIIDGLKNKYRSLHGRDVRIRAWE
KVLVDTTCRNSALLMNKLQKLVLMEKWIFSKCCQDCPNLKDYLQEAIMGTLHESLRNSVK
QRLYNIPHNVGINHEEFLINTVIETVIDLSPIADDQIENSCMYCKSVFHCSINCKKKPNR
ELRPDSTNFSKTYYLQGAQRQQQLKSSAKRTKVLEQDTKKVKQSVQQQKTGNY
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccccagtgagggatgaaacaagaaatgttattgacgacaacatttctgcgcgg
attcaatcgaaagtcaaaacaaatgatactgtcagacagacgccatcatcattaagaaaa
gtttctattaaagatgaacaggtgaaacaatatcaaagaaacttaaataggtttaaaacc
atactaaatggtttaaaggcagaagaggaaaaactttctgagactgatgatattcagatg
ctagctgaaaaattattaaaactcggagaaaccattgacaaggttgagaataggattgtg
gatctagttgaaaagatacaattattggaaacaaacgagaacaataatatattacatgaa
catatagatgctacagggacttactatttattcgatacgttaacttcaaccaacaaaaga
ttctaccctaaggattgtgtttttgattataggactaataatgtcgagaacattcctatt
ctcttaaacaattttaaaaaattcatcaagaaatatcaatttgatgatgtctttgaaaat
gatatcatagaaatcgatcctcgtgaaaatgaaatcttgtgcaagataatcaaagaagga
ctcggtgaaagtttagatatcatgaacacaaatacaactgacatttttaggataatcgat
ggtttaaaaaacaaatatagaagtttacatggtagagatgtcagaattagagcctgggaa
aaggttttggttgatacaacatgtagaaattccgcattgttaatgaataaacttcaaaag
ttggtactaatggaaaaatggattttttctaaatgctgccaagattgtcctaatctaaag
gattacctacaagaagctatcatgggaaccttacatgaatccttaagaaattctgtgaaa
caacgtttgtacaacattccacataacgtaggaattaatcacgaagaatttctaatcaat
actgttattgaaacagtaattgatttgagcccaattgcagacgatcaaatagaaaatagc
tgcatgtattgcaaatctgttttccattgctcaattaactgcaaaaagaaaccaaatagg
gaacttaggcctgactcgaccaatttctcaaaaacctattatctacaaggtgcacagaga
caacaacaacttaagtccagtgcaaaacgaacaaaagtcttggaacaagacacaaaaaaa
gtcaaacaaagtgtacaacagcaaaaaactggtaattattga

DBGET integrated database retrieval system