KEGG   Saccharomyces cerevisiae (budding yeast): YHL012WHelp
Entry
YHL012W           CDS       T00005                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:sce00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sce00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sce00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sce00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VIII:78936..80417
Genome map
AA seq 493 aa AA seqDB search
MTVFSGVNKIEFEGTFEGIGKDVVMSQMIRALQKHFPSIRDKNYEFSLFLHIFQRYVLEN
TSITHDLVCDKIRLPIIDEVVELDDIKNYGLLEGKLLSKLAILKLTGKANPIIGKESPLF
EVKNGMSSLDVIVRQTQNLNVRYNSDVPLIFMTSLETESQVSNFLEEHYSSSKVRWKTVV
QSSFPQIDKDRLLPIDLQINSHENDFWYPCGTGNLTDTLYFSGELDKLIAQGKEILFVSN
VDNLGATGDLNILNFIINEKIEYLVEVVERTANVSNTGVLATYKGKLRSVYYNCLSNESA
STCRIVNTNNIWIDLKKLKVLIESNSLNLPIHSSESKITHKNEEIECLQFKTQLVDCIAF
FPNSRVLKVSRDRFLPLRTCKDLFLLKSTLYDLDSNGTFNLYPLKFGLLPSIDLGDEFAT
YETFKIGVPDIPNILELEHLTVMGNVFFGRNITLKGTVIIICDENDVITVPDGSILENVT
IWHKSQLEDMNGY
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgacggttttctctggagtaaataaaatagagtttgaaggtactttcgaaggtattgga
aaggatgttgttatgtcacaaatgataagggccttgcagaaacattttccttcgatacgt
gacaagaattatgagtttagcctatttttgcacatttttcaaagatatgtcttagaaaat
acttcaatcacccatgatctagtttgtgacaaaattagattaccgataattgatgaagtg
gttgaactcgatgatattaaaaattacggtttgttagagggtaaactattatcaaagtta
gctattttaaaattaaccggaaaggctaatccaatcattggtaaagaaagccctttattc
gaagtaaaaaatgggatgtcttcattggatgtaatagttcgacaaacgcaaaatttgaat
gtacgatataattcagacgttcctcttatatttatgacctcgcttgaaactgaatctcaa
gtatcaaacttccttgaagagcattattcttctagcaaagtgagatggaaaaccgtagtt
cagtcaagctttccacaaattgataaagatagattattacctatcgatttacaaataaat
tctcatgaaaatgatttttggtatccttgcgggactggtaacctaactgacactttgtat
ttttcaggagaattggacaaattaattgctcaaggaaaagagattttatttgtttcaaat
gttgacaatttgggcgctacaggagatttgaacattttaaatttcatcataaatgaaaaa
atcgagtatcttgttgaagtagttgaaaggactgcaaatgtttcaaacactggagtgttg
gcaacatataaaggtaaactacgatcggtttattacaactgcttatccaatgaaagtgca
agcacgtgtcgaattgtcaacactaataacatttggattgatttgaaaaagctaaaggtg
ctaatagagtctaatagtttaaatttgccaattcattctagtgaaagtaaaataacacac
aaaaatgaagagatagagtgtcttcaatttaagacacagttggtcgattgtattgccttc
tttccgaacagtcgagtattgaaagtatcaagagacagatttttacccctaagaacatgt
aaggacttgtttttgttgaaatcaacattatatgatctcgattcaaatggaacatttaac
ctctaccctctgaaatttggattattaccttcaatcgacttgggcgatgagtttgcaact
tatgagacttttaagataggagtaccagatattcctaatattctggaattagagcattta
actgtgatgggaaatgtgttttttggtcgtaatataactctgaaagggacggtcattata
atatgtgatgaaaatgatgtaattactgttcccgatggctctattttggaaaatgtaacg
atttggcataaatctcagctggaggatatgaatggatattaa

DBGET integrated database retrieval system