KEGG   Saccharomyces cerevisiae (budding yeast): YHL032CHelp
Entry
YHL032C           CDS       T00005                                 

Gene name
GUT1
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    YHL032C (GUT1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     YHL032C (GUT1)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YHL032C (GUT1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VIII:complement(36379..38508)
Genome map
AA seq 709 aa AA seqDB search
MFPSLFRLVVFSKRYIFRSSQRLYTSLKQEQSRMSKIMEDLRSDYVPLIASIDVGTTSSR
CILFNRWGQDVSKHQIEYSTSASKGKIGVSGLRRPSTAPARETPNAGDIKTSGKPIFSAE
GYAIQETKFLKIEELDLDFHNEPTLKFPKPGWVECHPQKLLVNVVQCLASSLLSLQTINS
ERVANGLPPYKVICMGIANMRETTILWSRRTGKPIVNYGIVWNDTRTIKIVRDKWQNTSV
DRQLQLRQKTGLPLLSTYFSCSKLRWFLDNEPLCTKAYEENDLMFGTVDTWLIYQLTKQK
AFVSDVTNASRTGFMNLSTLKYDNELLEFWGIDKNLIHMPEIVSSSQYYGDFGIPDWIME
KLHDSPKTVLRDLVKRNLPIQGCLGDQSASMVGQLAYKPGAAKCTYGTGCFLLYNTGTKK
LISQHGALTTLAFWFPHLQEYGGQKPELSKPHFALEGSVAVAGAVVQWLRDNLRLIDKSE
DVGPIASTVPDSGGVVFVPAFSGLFAPYWDPDARATIMGMSQFTTASHIARAAVEGVCFQ
ARAILKAMSSDAFGEGSKDRDFLEEISDVTYEKSPLSVLAVDGGMSRSNEVMQIQADILG
PCVKVRRSPTAECTALGAAIAANMAFKDVNERPLWKDLHDVKKWVFYNGMEKNEQISPEA
HPNLKIFRSESDDAERRKHWKYWEVAVERSKGWLKDIEGEHEQVLENFQ
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgtttccctctctcttccgacttgtagtattctccaaacgttacatattccgatcaagc
cagcgcctttacactagtttaaaacaagaacagagccgtatgtccaaaataatggaagat
ttacgaagtgactacgtcccgcttatcgccagtattgatgtaggaacgacctcatccaga
tgcattctgttcaacagatggggccaggacgtttcaaaacaccaaattgaatattcaact
tcagcatcgaagggcaagattggggtgtctggcctaaggagaccctctacagccccagct
cgtgaaacaccaaacgccggtgacatcaaaaccagcggaaagcccatcttttctgcagaa
ggctatgccattcaagaaaccaaattcctaaaaatcgaggaattggacttggacttccat
aacgaacccacgttgaagttccccaaaccgggttgggttgagtgccatccgcagaaatta
ctggtgaacgtcgtccaatgccttgcctcaagtttgctctctctgcagactatcaacagc
gaacgtgtagcaaacggtctcccaccttacaaggtaatatgcatgggtatagcaaacatg
agagaaaccacaattctgtggtcccgccgcacaggaaaaccaattgttaactacggtatt
gtttggaacgacaccagaacgatcaaaatcgttagagacaaatggcaaaacactagcgtc
gataggcaactgcagcttagacagaagactggattgccattgctctccacgtatttctcc
tgttccaagctgcgctggttcctcgacaatgagcctctgtgtaccaaggcgtatgaggag
aacgacctgatgttcggcactgtggacacatggctgatttaccaattaactaaacaaaag
gcgttcgtttctgacgtaaccaacgcttccagaactggatttatgaacctctccacttta
aagtacgacaacgagttgctggaattttggggtattgacaagaacctgattcacatgccc
gaaattgtgtcctcatctcaatactacggtgactttggcattcctgattggataatggaa
aagctacacgattcgccaaaaacagtactgcgagatctagtcaagagaaacctgcccata
cagggctgtctgggcgaccaaagcgcatccatggtggggcaactcgcttacaaacccggt
gctgcaaaatgtacttatggtaccggttgctttttactgtacaatacggggaccaaaaaa
ttgatctcccaacatggcgcactgacgactctagcattttggttcccacatttgcaagag
tacggtggccaaaaaccagaattgagcaagccacattttgcattagagggttccgtcgct
gtggctggtgctgtggtccaatggctacgtgataatttacgattgatcgataaatcagag
gatgtcggaccgattgcatctacggttcctgattctggtggcgtagttttcgtccccgca
tttagtggcctattcgctccctattgggacccagatgccagagccaccataatggggatg
tctcaattcactactgcctcccacatcgccagagctgccgtggaaggtgtttgctttcaa
gccagggctatcttgaaggcaatgagttctgacgcgtttggtgaaggttccaaagacagg
gactttttagaggaaatttccgacgtcacatatgaaaagtcgcccctgtcggttctggca
gtggatggcgggatgtcgaggtctaatgaagtcatgcaaattcaagccgatatcttaggt
ccctgtgtcaaagtcagaaggtctccgacagcggaatgtaccgcattgggggcagccatt
gcagccaatatggctttcaaggatgtgaacgagcgcccattatggaaggacctacacgat
gttaagaaatgggtcttttacaatggaatggagaaaaacgaacaaatatcaccagaggct
catccaaaccttaagatattcagaagtgaatccgacgatgctgaaaggagaaagcattgg
aagtattgggaagttgccgtggaaagatccaaaggttggctgaaggacatagaaggtgaa
cacgaacaggttctagaaaacttccaataa

DBGET integrated database retrieval system