KEGG   Saccharomyces cerevisiae (budding yeast): YHR029CHelp
Entry
YHR029C           CDS       T00005                                 

Gene name
YHI9
Definition
Yhi9p (EC:5.1.-.-)
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
VIII:complement(167677..168561)
Genome map
AA seq 294 aa AA seqDB search
MTLMVPFKQVDVFTEKPFMGNPVAVINFLEIDENEVSQEELQAIANWTNLSETTFLFKPS
DKKYDYKLRIFTPRSELPFAGHPTIGSCKAFLEFTKNTTATSLVQECKIGAVPITINEGL
ISFKAPMADYESISSEMIADYEKAIGLKFIKPPALLHTGPEWIVALVEDAETCFNANPNF
AMLAHQTKQNDHVGIILAGPKKEAAIKNSYEMRAFAPVINVYEDPVCGSGSVALARYLQE
VYKFEKTTDITISEGGRLKRNGLMLASIKKEADNSTSYYIAGHATTVIDGKIKV
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgactttaatggtacctttcaaacaagttgatgtattcactgagaagccctttatggga
aatccagtagcagtaataaacttcttggaaattgatgaaaatgaagtcagtcaagaagaa
ttgcaggcaattgccaactggacaaacttatcagaaacaacgtttttatttaaaccatct
gataaaaagtatgattacaagttgaggatctttactccaagaagtgaattgccatttgct
ggtcacccaaccattggttcatgtaaggctttccttgagttcaccaaaaacaccactgcg
acttctctcgtccaggaatgtaaaataggcgctgttccaataacaattaatgagggacta
attagcttcaaagctccgatggctgattacgaaagtatatcgagtgagatgattgctgat
tatgaaaaagcgattggtttgaaattcataaagcctcctgctcttttacatactgggcca
gagtggatcgtggcgctagtagaagatgcagaaacttgcttcaatgcaaacccaaatttt
gctatgcttgcacaccagacaaaacagaatgaccatgtgggaattatcctagcgggccct
aaaaaggaagccgccatcaaaaactcctacgaaatgagggcgtttgctccggtgataaac
gtttatgaagatcctgtttgtggtagtggttctgtagcccttgcaagatatttgcaagaa
gtttataagtttgagaaaaccacggatattaccatttctgagggtggaaggttaaaaaga
aatggcctaatgttagcttcaattaagaaagaagctgataatagcacttcctactatata
gcaggtcatgccactaccgttattgatggtaagatcaaagtttag

DBGET integrated database retrieval system