KEGG   Saccharomyces cerevisiae (budding yeast): YHR030CHelp
Entry
YHR030C           CDS       T00005                                 

Gene name
SLT2, BYC2, LYT2, MPK1, SLK2
Definition
Slt2p (EC:2.7.11.24)
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:sce04011]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VIII:complement(168890..170344)
Genome map
AA seq 484 aa AA seqDB search
MADKIERHTFKVFNQDFSVDKRFQLIKEIGHGAYGIVCSARFAEAAEDTTVAIKKVTNVF
SKTLLCKRSLRELKLLRHFRGHKNITCLYDMDIVFYPDGSINGLYLYEELMECDMHQIIK
SGQPLTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSE
NPVENSQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSAGCILAEFLGGKPIFKGKDYVN
QLNQILQVLGTPPDETLRRIGSKNVQDYIHQLGFIPKVPFVNLYPNANSQALDLLEQMLA
FDPQKRITVDEALEHPYLSIWHDPADEPVCSEKFEFSFESVNDMEDLKQMVIQEVQDFRL
FVRQPLLEEQRQLQLQQQQQQQQQQQQQQQQPSDVDNGNAAASEENYPKQMATSNSVAPQ
QESFGIHSQNLPRHDADFPPRPQESMMEMRPATGNTADIPPQNDNGTLLDLEKELEFGLD
RKYF
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggctgataagatagagaggcatactttcaaggtcttcaatcaagatttcagtgtagat
aagaggtttcaacttatcaaagaaatagggcatggagcatacggcatagtgtgttcagcg
cggtttgcagaagctgccgaagataccacagttgccatcaagaaagtgacaaacgttttt
tcgaagaccttactatgtaaaagatccctacgtgagctaaagcttttgagacatttcaga
ggccacaaaaatattacatgtctttatgatatggatattgttttttatccagacgggtct
atcaatggactatatctttatgaggaacttatggaatgtgatatgcaccaaatcatcaaa
tccggtcaacctttgacggatgctcactatcaaagtttcacataccaaatattatgtggt
ttaaagtatattcattctgcagatgtcttgcatcgtgatttgaagcccggcaatttgctt
gtcaatgcagattgtcaattgaaaatctgtgattttgggttagctagaggttattcggag
aatcctgtcgaaaacagtcaatttttgacggagtacgtggccactagatggtatagagct
ccggaaataatgttgagttaccaaggatataccaaggcgattgacgtatggtcagctggc
tgtattttagcggagtttcttggtggaaagccaatcttcaaaggaaaggattacgttaat
caattgaatcaaatattacaagttttagggacacccccagacgaaactttaagaaggatt
ggttctaaaaatgttcaggactacatacatcaattaggtttcattccaaaagtacctttt
gtcaatttatacccaaatgccaattcacaagcattagacttattggagcaaatgctcgcg
tttgaccctcaaaagagaattaccgtggatgaggccctggagcatccttacttgtctata
tggcatgatccagctgacgaacctgtgtgtagtgaaaaattcgaatttagttttgaatcg
gttaatgatatggaggacttaaaacaaatggttatacaagaagtgcaagatttcaggctg
tttgtgagacaaccgctattagaagagcaaaggcaattacaattacagcagcagcaacag
cagcagcaacagcaacagcaacagcaacagcagccttcagatgtggataatggcaacgcc
gcagcgagtgaagaaaattatccaaaacagatggccacgtctaattctgttgcgccacaa
caagaatcatttggtattcactcccaaaatttgccaaggcatgatgcagatttcccacct
cgacctcaagagagtatgatggagatgagacctgccactggaaataccgcagatattccg
cctcagaatgataacggcacgcttctagaccttgaaaaagagctggagtttggattagat
agaaaatatttttag

DBGET integrated database retrieval system