KEGG   Saccharomyces cerevisiae (budding yeast): YHR042WHelp
Entry
YHR042W           CDS       T00005                                 

Gene name
NCP1, CPR1
Definition
Ncp1p (EC:1.6.2.4)
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     YHR042W (NCP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
VIII:190543..192618
Genome map
AA seq 691 aa AA seqDB search
MPFGIDNTDFTVLAGLVLAVLLYVKRNSIKELLMSDDGDITAVSSGNRDIAQVVTENNKN
YLVLYASQTGTAEDYAKKFSKELVAKFNLNVMCADVENYDFESLNDVPVIVSIFISTYGE
GDFPDGAVNFEDFICNAEAGALSNLRYNMFGLGNSTYEFFNGAAKKAEKHLSAAGAIRLG
KLGEADDGAGTTDEDYMAWKDSILEVLKDELHLDEQEAKFTSQFQYTVLNEITDSMSLGE
PSAHYLPSHQLNRNADGIQLGPFDLSQPYIAPIVKSRELFSSNDRNCIHSEFDLSGSNIK
YSTGDHLAVWPSNPLEKVEQFLSIFNLDPETIFDLKPLDPTVKVPFPTPTTIGAAIKHYL
EITGPVSRQLFSSLIQFAPNADVKEKLTLLSKDKDQFAVEITSKYFNIADALKYLSDGAK
WDTVPMQFLVESVPQMTPRYYSISSSSLSEKQTVHVTSIVENFPNPELPDAPPVVGVTTN
LLRNIQLAQNNVNIAETNLPVHYDLNGPRKLFANYKLPVHVRRSNFRLPSNPSTPVIMIG
PGTGVAPFRGFIRERVAFLESQKKGGNNVSLGKHILFYGSRNTDDFLYQDEWPEYAKKLD
GSFEMVVAHSRLPNTKKVYVQDKLKDYEDQVFEMINNGAFIYVCGDAKGMAKGVSTALVG
ILSRGKSITTDEATELIKMLKTSGRYQEDVW
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgccgtttggaatagacaacaccgacttcactgtcctggcggggctagtgcttgccgtg
ctactgtacgtaaagagaaactccatcaaggaactgctgatgtccgatgacggagatatc
acagctgtcagctcgggcaacagagacattgctcaggtggtgaccgaaaacaacaagaac
tacttggtgttgtatgcgtcgcagactgggactgccgaggattacgccaaaaagttttcc
aaggagctggtggccaagttcaacctaaacgtgatgtgcgcagatgttgagaactacgac
tttgagtcgctaaacgatgtgcccgtcatagtctcgatttttatctctacatatggtgaa
ggagacttccccgacggggcggtcaactttgaagactttatttgtaatgcggaagcgggt
gcactatcgaacctgaggtataatatgtttggtctgggaaattctacttatgaattcttt
aatggtgccgccaagaaggccgagaagcatctctccgccgcgggcgctatcagactaggc
aagctcggtgaagctgatgatggtgcaggaactacagacgaagattacatggcctggaag
gactccatcctggaggttttgaaagacgaactgcatttggacgaacaggaagccaagttc
acctctcaattccagtacactgtgttgaacgaaatcactgactccatgtcgcttggtgaa
ccctctgctcactatttgccctcgcatcagttgaaccgcaacgcagacggcatccaattg
ggtcccttcgatttgtctcaaccgtatattgcacccatcgtgaaatctcgcgaactgttc
tcttccaatgaccgtaattgcatccactctgaatttgacttgtccggctctaacatcaag
tactccactggtgaccatcttgctgtttggccttccaacccattggaaaaggtcgaacag
ttcttatccatattcaacctggaccctgaaaccatttttgacttgaagcccctggatccc
accgtcaaagtgcccttcccaacgccaactactattggcgctgctattaaacactatttg
gaaattacaggacctgtctccagacaattgttttcatctttgattcagttcgcccccaac
gctgacgtcaaggaaaaattgactctgctttcgaaagacaaggaccaattcgccgtcgag
ataacctccaaatatttcaacatcgcagatgctctgaaatatttgtctgatggcgccaaa
tgggacaccgtacccatgcaattcttggtcgaatcagttccccaaatgactcctcgttac
tactctatctcttcctcttctctgtctgaaaagcaaaccgtccatgtcacctccattgtg
gaaaactttcctaacccagaattgcctgatgctcctccagttgttggtgttacgactaac
ttgttaagaaacattcaattggctcaaaacaatgttaacattgccgaaactaacctacct
gttcactacgatttaaatggcccacgtaaacttttcgccaattacaaattgcccgtccac
gttcgtcgttctaacttcagattgccttccaacccttccaccccagttatcatgatcggt
ccaggtaccggtgttgccccattccgtgggtttatcagagagcgtgtcgcgttcctcgaa
tcacaaaagaagggcggtaacaacgtttcgctaggtaagcatatactgttttatggatcc
cgtaacactgatgatttcttgtaccaggacgaatggccagaatacgccaaaaaattggat
ggttcgttcgaaatggtcgtggcccattccaggttgccaaacaccaaaaaagtttatgtt
caagataaattaaaggattacgaagaccaagtatttgaaatgattaacaacggtgcattt
atctacgtctgtggtgatgcaaagggtatggccaagggtgtgtcaaccgcattggttggc
atcttatcccgtggtaaatccattaccactgatgaagcaacagagctaatcaagatgctc
aagacttcaggtagataccaagaagatgtctggtaa

DBGET integrated database retrieval system