KEGG   Saccharomyces cerevisiae (budding yeast): YHR104WHelp
Entry
YHR104W           CDS       T00005                                 

Gene name
GRE3
Definition
trifunctional aldehyde reductase/xylose reductase/glucose 1-dehydrogenase (NADP(+)) (EC:1.1.1.21 1.1.1.-)
Orthology
K17743  
D-xylose reductase [EC:1.1.1.307]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Pentose and glucuronate interconversions
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YHR104W (GRE3)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.307  D-xylose reductase
     YHR104W (GRE3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VIII:323409..324392
Genome map
AA seq 327 aa AA seqDB search
MSSLVTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIR
KAISEGLVSRKDIFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYVP
FEEKYPPGFYTGADDEKKGHITEAHVPIIDTYRALEECVDEGLIKSIGVSNFQGSLIQDL
LRGCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKTTPTL
FENDVIKKVSQNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQEL
KDISALNANIRFNDPWTWLDGKFPTFA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcactggttactcttaataacggtctgaaaatgcccctagtcggcttagggtgc
tggaaaattgacaaaaaagtctgtgcgaatcaaatttatgaagctatcaaattaggctac
cgtttattcgatggtgcttgcgactacggcaacgaaaaggaagttggtgaaggtatcagg
aaagccatctccgaaggtcttgtttctagaaaggatatatttgttgtttcaaagttatgg
aacaattttcaccatcctgatcatgtaaaattagctttaaagaagaccttaagcgatatg
ggacttgattatttagacctgtattatattcacttcccaatcgccttcaaatatgttcca
tttgaagagaaataccctccaggattctatacgggcgcagatgacgagaagaaaggtcac
atcaccgaagcacatgtaccaatcatagatacgtaccgggctctggaagaatgtgttgat
gaaggcttgattaagtctattggtgtttccaactttcagggaagcttgattcaagattta
ttacgtggttgtagaatcaagcccgtggctttgcaaattgaacaccatccttatttgact
caagaacacctagttgagttttgtaaattacacgatatccaagtagttgcttactcctcc
ttcggtcctcaatcattcattgagatggacttacagttggcaaaaaccacgccaactctg
ttcgagaatgatgtaatcaagaaggtctcacaaaaccatccaggcagtaccacttcccaa
gtattgcttagatgggcaactcagagaggcattgccgtcattccaaaatcttccaagaag
gaaaggttacttggcaacctagaaatcgaaaaaaagttcactttaacggagcaagaattg
aaggatatttctgcactaaatgccaacatcagatttaatgatccatggacctggttggat
ggtaaattccccacttttgcctga

DBGET integrated database retrieval system