KEGG   Saccharomyces cerevisiae (budding yeast): YHR118CHelp
Entry
YHR118C           CDS       T00005                                 

Gene name
ORC6
Definition
origin recognition complex subunit 6
Orthology
K02608  
origin recognition complex subunit 6
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Module
Origin recognition complex
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:sce04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:sce04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VIII:complement(344321..345628)
Genome map
AA seq 435 aa AA seqDB search
MSMQQVQHCVAEVLRLDPQEKPDWSSGYLKKLTNATSILYNTSLNKVMLKQDEEVARCHI
CAYIASQKMNEKHMPDLCYYIDSIPLEPKKAKHLMNLFRQSLSNSSPMKQFAWTPSPKKN
KRSPVKNGGRFTSSDPKELRNQLFGTPTKVRKSQNNDSFVIPELPPMQTNESPSITRRKL
AFEEDEDEDEEEPGNDGLSLKSHSNKSITGTRNVDSDEYENHESDPTSEEEPLGVQESRS
GRTKQNKAVGKPQSELKTAKALRKRGRIPNSLLVKKYCKMTTEEIIRLCNDFELPREVAY
KIVDEYNINASRLVCPWQLVCGLVLNCTFIVFNERRRKDPRIDHFIVSKMCSLMLTSKVD
DVIECVKLVKELIIGEKWFRDLQIRYDDFDGIRYDEIIFRKLGSMLQTTNILVTDDQYNI
WKKRIEMDLALTEPL
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgcaacaagtccaacattgtgtcgcagaagtacttcgactagatccacaagaa
aaaccggactggtcgagcggatatttgaagaagttgactaatgcgacatcgattttatat
aatacttcactgaacaaggtaatgctgaaacaagatgaagaggttgctagatgtcacata
tgtgcatacatagcgtcacagaaaatgaatgaaaaacacatgcctgacctttgctattat
atagacagtattcccttggagccgaaaaaagccaagcatttaatgaaccttttcagacaa
agtttatctaattcttcacctatgaaacaatttgcttggacaccgagccccaaaaagaac
aaacgcagtccagtaaagaacggtgggaggtttacttcttctgatccgaaagagttgagg
aatcaactgtttggtacaccaactaaagttaggaaaagccaaaataatgattcgttcgta
ataccagaactaccccccatgcaaaccaatgaatcgccgtctattactaggagaaagtta
gcatttgaagaggatgaggatgaggatgaagaggaaccaggaaacgacggtttgtcttta
aaaagccatagtaataagagcattactggaaccagaaatgtagattctgatgagtatgaa
aaccatgaaagtgaccctacaagtgaggaagagccattaggtgtgcaagaaagcagaagc
gggagaacgaaacaaaataaggcagttggaaaaccgcaatcagaattgaagacggcaaaa
gccctgaggaaaaggggcagaataccaaattctttgttagtaaagaagtattgcaaaatg
actactgaagaaataatacggctttgcaacgattttgaattaccaagagaagtagcatat
aaaattgtggatgagtacaacataaacgcgtcaagattggtttgcccatggcaattagtg
tgtgggttagtattaaattgtacattcattgtatttaatgaaagaagacgcaaggatcca
agaattgaccattttatagtcagtaagatgtgcagcttgatgttgacgtcaaaagtggat
gatgttattgaatgtgtaaaattagtgaaggaattaattatcggtgaaaaatggttcaga
gatttgcaaattaggtatgatgattttgatggcatcagatacgatgaaattatatttagg
aaactgggatcgatgttacaaaccaccaatattttggtcacagacgaccagtacaatatt
tggaagaaaagaattgaaatggatttggcattaacagaacctttataa

DBGET integrated database retrieval system