KEGG   Saccharomyces cerevisiae (budding yeast): YHR152WHelp
Entry
YHR152W           CDS       T00005                                 

Gene name
SPO12
Definition
Spo12p
Orthology
K12576  
sporulation-specific protein 12
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YHR152W (SPO12)
   04113 Meiosis - yeast
    YHR152W (SPO12)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VIII:401434..401955
Genome map
AA seq 173 aa AA seqDB search
MSNKASDQSARTASILKTDITRENTITRSSSSNNDNYHHHNNINNYNESAKTGEDANKEN
IPNLEEEIAAFRIFRKKSTSNLKSSHTTSNLVKKTMFKRDLLKQDPKRKLQLQQRFASPT
DRLVSPCSLKLNEHKVKMFGKKKKVNPMKLNFKGNLAADSEDVEIDEDEEYFY
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacaaggcaagtgaccaatcagcacgcacggcttccatcctcaagactgatatt
accagagaaaacacaatcaccagaagcagcagcagcaacaacgacaactaccatcaccac
aataacatcaataattacaatgaatcggcgaagacaggagaggacgccaataaagagaat
atacctaatttagaggaggagattgcggcctttcgaatttttaggaaaaaaagcacttca
aacttgaagtcgtcacacaccactagcaatttggtaaaaaagacaatgttcaaaagggat
cttttaaaacaggatccgaagaggaaactccaactacaacaaagatttgcatcaccgact
gacaggctggtatcaccatgctcattgaaattgaatgagcacaaagttaagatgttcgga
aagaaaaagaaagtcaatcctatgaaactgaactttaaaggcaaccttgctgccgattca
gaggatgtagaaatcgatgaagatgaggagtatttctactaa

DBGET integrated database retrieval system