KEGG   Saccharomyces cerevisiae (budding yeast): YHR166CHelp
Entry
YHR166C           CDS       T00005                                 

Gene name
CDC23
Definition
anaphase promoting complex subunit CDC23
Orthology
K03355  
anaphase-promoting complex subunit 8
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YHR166C (CDC23)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YHR166C (CDC23)
   04113 Meiosis - yeast
    YHR166C (CDC23)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     YHR166C (CDC23)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VIII:complement(437170..439050)
Genome map
AA seq 626 aa AA seqDB search
MNDDSQDKIIHDIRIQLRKAATELSRWKLYGSSKWAAEALAGLAEAIDVDQTHSLADESP
LRNKQGVPKQMFEIPQNGFGLSETEYDLYLLGSTLFDAKEFDRCVFFLKDVTNPYLKFLK
LYSKFLSWDKKSQESMENILTTGKFTDEMYRANKDGDGSGNEDINQSGHQRANLKMVSNE
HESQSNISSILKEINTFLESYEIKIDDDEADLGLALLYYLRGVILKQEKNISKAMSSFLK
SLSCYSFNWSCWLELMDCLQKVDDALLLNNYLYQNFQFKFSENLGSQRTIEFNIMIKFFK
LKVFEELNGQLEDYFEDLEFLLQVFPNFTFLKAYNATISYNNLDYVTAESRFDDIVKQDP
YRLNDLETYSNILYVMQKNSKLAYLAQFVSQIDRFRPETCCIIANYYSARQEHEKSIMYF
RRALTLDKKTTNAWTLMGHEFVELSNSHAAIECYRRAVDICPRDFKAWFGLGQAYALLDM
HLYSLYYFQKACTLKPWDRRIWQVLGECYSKTGNKVEAIKCYKRSIKASQTVDQNTSIYY
RLAQLYEELEDLQECKKFMMKCVDVEELLEGIVTDETVKARLWLAIFEIKAGNYQLAYDY
AMGVSSGTSQEIEEARMLARECRRHM
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacgacagccaggataaaataatacatgatatacgtattcagctacgaaaggct
gccacagaattatcacgatggaagctatacggctcctcaaagtgggcagcagaggcgcta
gcaggtcttgcagaagctattgatgttgatcaaacacactctttagccgatgaatcgcca
ctaagaaataaacaaggtgtaccgaaacagatgtttgaaataccacaaaacgggtttggc
ctatcagagactgagtatgacctgtacctccttggttctacgttgtttgatgctaaagag
tttgatcgatgcgttttttttctaaaagatgtcactaatccataccttaagttcttaaaa
ttatacagtaaatttctatcgtgggataagaaaagccaggaaagtatggaaaatatctta
actacagggaagtttacggacgaaatgtacagagctaacaaagatggggatggtagtggg
aatgaggatataaatcaaagtgggcaccaacgcgccaatttaaaaatggtcagcaatgag
catgagtcacaatcgaacatatcatctattttgaaggaaattaacacatttctggagtct
tatgaaataaagatagacgatgatgaggccgatttagggttagcactgttgtattattta
cgaggggtcatcttaaagcaagagaagaatatttctaaggcaatgtcgtcattcttgaaa
tctctgagttgctactcctttaactggtcctgctggctggagttaatggactgtttacaa
aaggttgacgatgcattgcttttaaataattatctatatcaaaatttccaattcaaattt
tctgaaaatcttggtagtcaacgaacgatagaatttaatataatgatcaaatttttcaag
ctaaaagtgtttgaggagcttaatggccagttagaggactactttgaagatttagagttt
ttgttacaagttttccccaatttcacttttttaaaggcttacaatgctactattagttac
aacaatttggattatgttaccgcagaaagccgatttgatgacatcgttaaacaagatccg
taccgtctcaacgatttggaaacctactccaatattctatacgtcatgcagaagaattca
aaattagcctatttggcgcaattcgtctcccaaatagatagatttagaccggaaacatgt
tgtatcatagcgaactattacagtgcccgacaggaacatgaaaaatctatcatgtatttc
cgtcgagcactaactttggataaaaaaacaacaaacgcatggactttgatgggtcacgaa
tttgttgaactaagcaattcacatgccgcaatagaatgctatcgtcgggccgtagatata
tgccctcgagacttcaaagcatggtttggtttgggccaggcttatgctctcctggacatg
catttatattctctttactacttccagaaagcttgcactttgaaaccttgggatcgtcgg
atttggcaagtattgggagaatgttatagtaagacgggaaataaggtagaagctataaaa
tgctacaaaagatccataaaagcttcacaaacggtcgatcaaaatacttcaatatattac
cggttagcgcaactatatgaagaacttgaagacttgcaagaatgtaagaagttcatgatg
aaatgtgtagatgtggaagaacttctggaaggtatagtaacagatgaaaccgtgaaggct
aggctttggctggcaatatttgagattaaggcaggaaactaccaattggcttatgattat
gccatgggggtatctagtggaacgtctcaagagattgaagaggctcgtatgctggctcgg
gagtgcagaaggcatatgtag

DBGET integrated database retrieval system