KEGG   Saccharomyces cerevisiae (budding yeast): YHR186CHelp
Entry
YHR186C           CDS       T00005                                 

Gene name
KOG1, LAS24
Definition
Kog1p
Orthology
K07204  
regulatory associated protein of mTOR
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VIII:complement(475999..480672)
Genome map
AA seq 1557 aa AA seqDB search
MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTNGNPIPEEDKQ
RDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDVMKTHPCARVEAWVDPLNFQD
SKKAIEQIGKNLQAQYETLSLRTRYKQSLDPCVEDVKRFCNSLRRTSKEDRILFHYNGHG
VPKPTKSGEIWVFNRGYTQYIPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRI
KDDEEGNHDVAAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF
LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTPLGELNWIFTA
ITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMPWYNCHPVSDPELPDSITTHP
MWKSWDLAMDEVLTKIVIDLKNAPPATALESQMILQQQETLQNGGSSKSNAQDTKAGSIQ
TQSRFAVANLSTMSLVNNPALQSRKSISLQSSQQQLQQQQQQQQQFTGFFEQNLTAFELW
LKYASNVRHPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVLKL
LQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDWGVNGMSATNGSA
MINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHNNLPFYHSNDTTDEQKAMAVFVL
ASFVRNFPLGQKNCFSLELVNKLCFYIDNSEIPLLRQWCVILLGLLFADNPLNRFVCMNT
GAVEILLKSLKDPVPEVRTASIFALKHFISGFQDAEVILRLQQEFEEQYQQLHSQLQHLQ
NQSHLQQQQSQQQQQHLEQQQMKIEKQIRHCQVMQNQLEVIDLRKLKRQEIGNLISILPL
INDGSSLVRKELVVYFSHIVSRYSNFFIVVVFNDLLEEIKLLEKSDINTRNTSDKYSVSQ
GSIFYTVWKSLLILAEDPFLENKELSKQVIDYILLELSAHKELGGPFAVMEKFLLKRSSK
AHQTGKFGFNSSQVQFVKSSLRSFSPNERVDNNAFKKEQQQHDPKISHPMRTSLAKLFQS
LGFSESNSDSDTQSSNTSMKSHTSKKGPSGLYLLNGNNNIYPTAETPRFRKHTEPLQLPL
NSSFLDYSREYFQEPQMKKQEADEPGSVEYNARLWRRNRNETIIQETQGEKKLSIYGNWS
KKLISLNNKSQPKLMKFAQFEDQLITADDRSTITVFDWEKGKTLSKFSNGTPFGTKVTDL
KLINEDDSALLLTGSSDGVIKIYRDYQDVDTFKIVSAWRGLTDMLLTPRSTGLLTEWLQI
RGSLLTTGDVKVIRVWDAHTETVEVDIPAKTSSLITSLTADQLAGNIFVAGFADGSLRVY
DRRLDPRDSMIRRWRAGNDKQGVWINNVHLQRGGYRELVSGATNGVVELWDIRSEDPVES
FVDQNVTSQYGSQQKPTTMTCMQVHEHAPIIATGTKQIKIWTTSGDLLNSFKNSHNNGVT
STLAATGIPKSLSYSSTSDAFLSSMAFHPHRMMIAATNSHDSIVNIYKCEDERIDYF
NT seq 4674 nt NT seq  +upstreamnt  +downstreamnt
atgccggagatttatggacctcagccattaaagccactcaatacggtgatgagacatggg
tttgaagagcaataccaaagtgaccaacttttacaatcactcgcgaatgatttcatattc
tactttgatgataaacgacacaaaactaatggaaatccgattcctgaagaggataaacaa
cgagatgtaaatcgttattaccagccgattaccgattggaagattatgaaagatcgacag
aagacagtaagtgcggcccttttattatgcttgaatttaggtgtcgatccccctgatgtt
atgaagacacatccctgtgccagagttgaagcatgggtagacccattgaatttccaggac
tcgaagaaagcaatagaacaaattggtaaaaacttacaagcacagtacgaaactctgtct
ttgagaacacgctataaacaaagcttggatccttgtgtagaggatgtcaaacggttttgc
aactcgctaagaagaacttctaaggaagataggatacttttccactacaacggacatggt
gtgcctaagcctacaaaatcaggtgaaatttgggttttcaacagaggttatacacaatat
attccggtatctttgtatgacctgcaaacttggttaggtgcgccatgtatatttgtctat
gattgcaacagtgctgaaaatatattaatcaactttcagaagtttgtgcaaaagaggatt
aaagatgatgaagagggaaatcatgatgttgccgcgccatcaccaacttcagcttatcaa
gattgtttccaattagcctcttgcacttccgatgaacttttacttatgagtccggaacta
cccgcagatttgtttagttgttgtttgacctgtccaatagagattagcatccgtatcttt
ctcatgcagtcacccttaaaagattctaaatataaaattttcttcgaaaatagtacttca
aatcaaccgtttggtgatagtaagaactcgttcaagtccaaaatacccaacgtcaatatc
cctggaatgttgtcggataggagaacgccgttgggagaactaaattggatttttacagct
ataacggacacaattgcatggacatccctcccccgaccacttttcaaaaaattattcaga
catgatttaatgattgctgcgcttttcagaaattttcttctagccaaaagaataatgccg
tggtacaattgccatcctgtatctgatccagaattaccagatagtataaccacacatcca
atgtggaaatcttgggatttagccatggatgaagtactgactaaaatagtcattgatctg
aaaaatgctcctcccgctactgccttagagagtcagatgattctacaacaacaagaaacc
ttacagaatggtggcagctctaagtcgaatgcccaagatacgaaagccggaagtattcaa
acacaatcgagatttgcagtggccaatttaagtacaatgtctctagtaaataaccctgct
ctccaatcaagaaaatctatatctttgcaaagctcacagcaacaattacagcagcagcaa
caacaacaacaacaatttacaggattttttgaacaaaatttgactgcttttgaattgtgg
ttgaaatatgcttcaaatgtcagacacccgcctgagcagcttcctatcgttttacaggtt
cttctttcgcaagtgcatcgtatacgtgcgttggtacttttatccagatttttagattta
ggcccgtgggctgtctacctgtcactttcaataggtatcttcccctacgttttgaagctg
ctacaaagtccagcacctgagttgaagcccatcctagtttttatttgggcccgtatcatg
tcaatagattacaaaaacacgcaaagtgaattaatcaaagaaaagggttatatgtatttt
gttacagtgttagtacctgattggggtgttaatggcatgtcagctacaaatggctcagcc
atgataaatagtgggaacccgttgacaatgactgcatcgcagaatataaatggtccatct
tcaagatattatgaacgccagcaaggaaatagaacatccaacttgggccacaataatctt
ccattttatcattctaatgataccaccgatgaacaaaaagctatggctgtctttgttttg
gcatcattcgttcgaaactttcctctggggcaaaaaaattgttttagtttggaactggtc
aacaagttgtgcttttatattgataattctgagatacccctactaagacagtggtgtgtt
attttattaggtttattgtttgctgataaccccttaaacaggtttgtatgtatgaatact
ggtgctgttgaaatattactaaaatctttgaaggaccctgtacctgaagttagaacagct
tctatatttgcattgaagcatttcatatctggatttcaagatgcagaggtaattttgaga
ttgcaacaagaatttgaagaacagtatcagcaattacattcgcaattacagcatctccaa
aatcaatcccatctacaacaacaacagtcccagcaacagcagcagcatcttgagcagcag
cagatgaaaattgaaaagcagattcgtcattgtcaagttatgcaaaatcaactagaagtt
attgatttgaggaagttaaaaagacaggaaattggcaacttgatctcaatcttaccttta
atcaatgatggttcatcattagtccgtaaggaactagtcgtatatttttcgcatattgtg
agtcgttactctaacttttttattgtagttgtattcaatgatttgttggaagaaataaaa
cttttagagaaaagtgatatcaatactcgaaacacttccgataagtattcagttagtcag
ggttccattttctacactgtttggaaatctctcttgattctagccgaagatcccttttta
gagaacaaggaattatccaagcaggttatagattatattttgcttgaattaagcgcccat
aaggaacttggtggaccatttgcagttatggaaaaatttttgttgaaaagaagctcgaaa
gctcaccaaactggtaaatttggatttaattcttcgcaggttcaatttgtaaaaagttca
ttacgatcattctcaccaaatgagagggtagataataatgcattcaaaaaagagcaacaa
cagcatgacccaaagatatctcatccaatgcggacatctttagctaaacttttccagagt
cttggttttagcgaatccaatagtgactctgatactcaatcatcaaatacttcgatgaaa
tcgcatacctcaaaaaagggtccctcgggcttatatttattgaatggcaataataatatt
tatcctacagctgagactccaagattccggaagcatacagaacccttacaattgccatta
aatagttcctttttagactattcacgtgaatattttcaagaaccacaaatgaaaaagcaa
gaggcggatgaacctggcagtgttgagtataatgctagattgtggagacgtaacagaaat
gaaactattatccaggaaacacagggggagaaaaaattatcgatttatgggaattggtcc
aaaaaattgattagtttaaataacaaaagtcaaccaaaactgatgaagtttgcccagttt
gaagatcagctgattactgcagatgatagaagtaccattacagtttttgattgggagaaa
ggaaagactttgtccaaattctccaatggtactccttttggcacaaaagttactgacctg
aaactcattaacgaggatgactccgcccttttattgacaggttcttcagacggtgttatc
aaaatatacagagactaccaagatgtcgacacctttaaaattgtatccgcctggagaggc
ttgaccgatatgttattgacacctagatccacaggtttactaaccgaatggttacaaata
agaggatcattgttaacaactggtgatgttaaggttatccgtgtctgggatgcgcataca
gaaacggttgaagtggacattcctgcaaaaacatcatctttaattacatccttgacggct
gatcagctagcaggtaatatcttcgtagcagggtttgcagatggctccctgagagtatat
gatcgccgtctcgatccaagagattccatgatacgtcgctggagagctggaaatgataag
cagggagtttggattaacaatgttcatttacaaagaggtggttacagagaattggtcagt
ggagctaccaatggtgttgtagagttatgggatataaggtccgaagatccggtagaatcg
tttgttgatcaaaacgtaacttctcagtacggttcgcaacaaaaaccaacgacaatgacg
tgcatgcaggttcatgagcatgctccgataattgcgacagggactaaacaaataaagata
tggacgacatctggagatcttttgaattcttttaaaaactcacataataatggcgtaaca
agtacattagccgctacgggaatcccaaagtcactgtcctactcttccacttctgatgca
tttttatcttcgatggctttccatcctcatagaatgatgattgcggccaccaattctcac
gattctattgtaaatatctacaagtgtgaagacgagagaattgattatttttga

  All links  
No link information was found.   
DBGET integrated database retrieval system