KEGG   Saccharomyces cerevisiae (budding yeast): YHR186CHelp
Entry
YHR186C           CDS       T00005                                 

Gene name
KOG1, LAS24
Definition
(RefSeq) ubiquitin-binding TORC1 subunit KOG1
  KO
K07204  regulatory associated protein of mTOR
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04136  Autophagy - other
sce04138  Autophagy - yeast
sce04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Transport and catabolism
   04138 Autophagy - yeast
    YHR186C (KOG1)
   04136 Autophagy - other eukaryotes
    YHR186C (KOG1)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    YHR186C (KOG1)
Membrane trafficking [BR:sce04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    YHR186C (KOG1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Raptor_N HEAT BBS2_Mid WD40 HEAT_2 Cnd1
Motif
Other DBs
NCBI-GeneID: 856593
NCBI-ProteinID: NP_012056
SGD: S000001229
UniProt: P38873
Position
VIII:complement(475999..480672)
Genome map
AA seq 1557 aa AA seqDB search
MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTNGNPIPEEDKQ
RDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDVMKTHPCARVEAWVDPLNFQD
SKKAIEQIGKNLQAQYETLSLRTRYKQSLDPCVEDVKRFCNSLRRTSKEDRILFHYNGHG
VPKPTKSGEIWVFNRGYTQYIPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRI
KDDEEGNHDVAAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF
LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTPLGELNWIFTA
ITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMPWYNCHPVSDPELPDSITTHP
MWKSWDLAMDEVLTKIVIDLKNAPPATALESQMILQQQETLQNGGSSKSNAQDTKAGSIQ
TQSRFAVANLSTMSLVNNPALQSRKSISLQSSQQQLQQQQQQQQQFTGFFEQNLTAFELW
LKYASNVRHPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVLKL
LQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDWGVNGMSATNGSA
MINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHNNLPFYHSNDTTDEQKAMAVFVL
ASFVRNFPLGQKNCFSLELVNKLCFYIDNSEIPLLRQWCVILLGLLFADNPLNRFVCMNT
GAVEILLKSLKDPVPEVRTASIFALKHFISGFQDAEVILRLQQEFEEQYQQLHSQLQHLQ
NQSHLQQQQSQQQQQHLEQQQMKIEKQIRHCQVMQNQLEVIDLRKLKRQEIGNLISILPL
INDGSSLVRKELVVYFSHIVSRYSNFFIVVVFNDLLEEIKLLEKSDINTRNTSDKYSVSQ
GSIFYTVWKSLLILAEDPFLENKELSKQVIDYILLELSAHKELGGPFAVMEKFLLKRSSK
AHQTGKFGFNSSQVQFVKSSLRSFSPNERVDNNAFKKEQQQHDPKISHPMRTSLAKLFQS
LGFSESNSDSDTQSSNTSMKSHTSKKGPSGLYLLNGNNNIYPTAETPRFRKHTEPLQLPL
NSSFLDYSREYFQEPQMKKQEADEPGSVEYNARLWRRNRNETIIQETQGEKKLSIYGNWS
KKLISLNNKSQPKLMKFAQFEDQLITADDRSTITVFDWEKGKTLSKFSNGTPFGTKVTDL
KLINEDDSALLLTGSSDGVIKIYRDYQDVDTFKIVSAWRGLTDMLLTPRSTGLLTEWLQI
RGSLLTTGDVKVIRVWDAHTETVEVDIPAKTSSLITSLTADQLAGNIFVAGFADGSLRVY
DRRLDPRDSMIRRWRAGNDKQGVWINNVHLQRGGYRELVSGATNGVVELWDIRSEDPVES
FVDQNVTSQYGSQQKPTTMTCMQVHEHAPIIATGTKQIKIWTTSGDLLNSFKNSHNNGVT
STLAATGIPKSLSYSSTSDAFLSSMAFHPHRMMIAATNSHDSIVNIYKCEDERIDYF
NT seq 4674 nt NT seq  +upstreamnt  +downstreamnt
atgccggagatttatggacctcagccattaaagccactcaatacggtgatgagacatggg
tttgaagagcaataccaaagtgaccaacttttacaatcactcgcgaatgatttcatattc
tactttgatgataaacgacacaaaactaatggaaatccgattcctgaagaggataaacaa
cgagatgtaaatcgttattaccagccgattaccgattggaagattatgaaagatcgacag
aagacagtaagtgcggcccttttattatgcttgaatttaggtgtcgatccccctgatgtt
atgaagacacatccctgtgccagagttgaagcatgggtagacccattgaatttccaggac
tcgaagaaagcaatagaacaaattggtaaaaacttacaagcacagtacgaaactctgtct
ttgagaacacgctataaacaaagcttggatccttgtgtagaggatgtcaaacggttttgc
aactcgctaagaagaacttctaaggaagataggatacttttccactacaacggacatggt
gtgcctaagcctacaaaatcaggtgaaatttgggttttcaacagaggttatacacaatat
attccggtatctttgtatgacctgcaaacttggttaggtgcgccatgtatatttgtctat
gattgcaacagtgctgaaaatatattaatcaactttcagaagtttgtgcaaaagaggatt
aaagatgatgaagagggaaatcatgatgttgccgcgccatcaccaacttcagcttatcaa
gattgtttccaattagcctcttgcacttccgatgaacttttacttatgagtccggaacta
cccgcagatttgtttagttgttgtttgacctgtccaatagagattagcatccgtatcttt
ctcatgcagtcacccttaaaagattctaaatataaaattttcttcgaaaatagtacttca
aatcaaccgtttggtgatagtaagaactcgttcaagtccaaaatacccaacgtcaatatc
cctggaatgttgtcggataggagaacgccgttgggagaactaaattggatttttacagct
ataacggacacaattgcatggacatccctcccccgaccacttttcaaaaaattattcaga
catgatttaatgattgctgcgcttttcagaaattttcttctagccaaaagaataatgccg
tggtacaattgccatcctgtatctgatccagaattaccagatagtataaccacacatcca
atgtggaaatcttgggatttagccatggatgaagtactgactaaaatagtcattgatctg
aaaaatgctcctcccgctactgccttagagagtcagatgattctacaacaacaagaaacc
ttacagaatggtggcagctctaagtcgaatgcccaagatacgaaagccggaagtattcaa
acacaatcgagatttgcagtggccaatttaagtacaatgtctctagtaaataaccctgct
ctccaatcaagaaaatctatatctttgcaaagctcacagcaacaattacagcagcagcaa
caacaacaacaacaatttacaggattttttgaacaaaatttgactgcttttgaattgtgg
ttgaaatatgcttcaaatgtcagacacccgcctgagcagcttcctatcgttttacaggtt
cttctttcgcaagtgcatcgtatacgtgcgttggtacttttatccagatttttagattta
ggcccgtgggctgtctacctgtcactttcaataggtatcttcccctacgttttgaagctg
ctacaaagtccagcacctgagttgaagcccatcctagtttttatttgggcccgtatcatg
tcaatagattacaaaaacacgcaaagtgaattaatcaaagaaaagggttatatgtatttt
gttacagtgttagtacctgattggggtgttaatggcatgtcagctacaaatggctcagcc
atgataaatagtgggaacccgttgacaatgactgcatcgcagaatataaatggtccatct
tcaagatattatgaacgccagcaaggaaatagaacatccaacttgggccacaataatctt
ccattttatcattctaatgataccaccgatgaacaaaaagctatggctgtctttgttttg
gcatcattcgttcgaaactttcctctggggcaaaaaaattgttttagtttggaactggtc
aacaagttgtgcttttatattgataattctgagatacccctactaagacagtggtgtgtt
attttattaggtttattgtttgctgataaccccttaaacaggtttgtatgtatgaatact
ggtgctgttgaaatattactaaaatctttgaaggaccctgtacctgaagttagaacagct
tctatatttgcattgaagcatttcatatctggatttcaagatgcagaggtaattttgaga
ttgcaacaagaatttgaagaacagtatcagcaattacattcgcaattacagcatctccaa
aatcaatcccatctacaacaacaacagtcccagcaacagcagcagcatcttgagcagcag
cagatgaaaattgaaaagcagattcgtcattgtcaagttatgcaaaatcaactagaagtt
attgatttgaggaagttaaaaagacaggaaattggcaacttgatctcaatcttaccttta
atcaatgatggttcatcattagtccgtaaggaactagtcgtatatttttcgcatattgtg
agtcgttactctaacttttttattgtagttgtattcaatgatttgttggaagaaataaaa
cttttagagaaaagtgatatcaatactcgaaacacttccgataagtattcagttagtcag
ggttccattttctacactgtttggaaatctctcttgattctagccgaagatcccttttta
gagaacaaggaattatccaagcaggttatagattatattttgcttgaattaagcgcccat
aaggaacttggtggaccatttgcagttatggaaaaatttttgttgaaaagaagctcgaaa
gctcaccaaactggtaaatttggatttaattcttcgcaggttcaatttgtaaaaagttca
ttacgatcattctcaccaaatgagagggtagataataatgcattcaaaaaagagcaacaa
cagcatgacccaaagatatctcatccaatgcggacatctttagctaaacttttccagagt
cttggttttagcgaatccaatagtgactctgatactcaatcatcaaatacttcgatgaaa
tcgcatacctcaaaaaagggtccctcgggcttatatttattgaatggcaataataatatt
tatcctacagctgagactccaagattccggaagcatacagaacccttacaattgccatta
aatagttcctttttagactattcacgtgaatattttcaagaaccacaaatgaaaaagcaa
gaggcggatgaacctggcagtgttgagtataatgctagattgtggagacgtaacagaaat
gaaactattatccaggaaacacagggggagaaaaaattatcgatttatgggaattggtcc
aaaaaattgattagtttaaataacaaaagtcaaccaaaactgatgaagtttgcccagttt
gaagatcagctgattactgcagatgatagaagtaccattacagtttttgattgggagaaa
ggaaagactttgtccaaattctccaatggtactccttttggcacaaaagttactgacctg
aaactcattaacgaggatgactccgcccttttattgacaggttcttcagacggtgttatc
aaaatatacagagactaccaagatgtcgacacctttaaaattgtatccgcctggagaggc
ttgaccgatatgttattgacacctagatccacaggtttactaaccgaatggttacaaata
agaggatcattgttaacaactggtgatgttaaggttatccgtgtctgggatgcgcataca
gaaacggttgaagtggacattcctgcaaaaacatcatctttaattacatccttgacggct
gatcagctagcaggtaatatcttcgtagcagggtttgcagatggctccctgagagtatat
gatcgccgtctcgatccaagagattccatgatacgtcgctggagagctggaaatgataag
cagggagtttggattaacaatgttcatttacaaagaggtggttacagagaattggtcagt
ggagctaccaatggtgttgtagagttatgggatataaggtccgaagatccggtagaatcg
tttgttgatcaaaacgtaacttctcagtacggttcgcaacaaaaaccaacgacaatgacg
tgcatgcaggttcatgagcatgctccgataattgcgacagggactaaacaaataaagata
tggacgacatctggagatcttttgaattcttttaaaaactcacataataatggcgtaaca
agtacattagccgctacgggaatcccaaagtcactgtcctactcttccacttctgatgca
tttttatcttcgatggctttccatcctcatagaatgatgattgcggccaccaattctcac
gattctattgtaaatatctacaagtgtgaagacgagagaattgattatttttga

DBGET integrated database retrieval system