KEGG   Saccharomyces cerevisiae (budding yeast): YHR186CHelp
Entry
YHR186C           CDS       T00005                                 

Gene name
KOG1, LAS24
Definition
(RefSeq) ubiquitin-binding TORC1 subunit KOG1
  KO
K07204  
regulatory associated protein of mTOR
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:sce00001]
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    YHR186C (KOG1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VIII:complement(475999..480672)
Genome map
AA seq 1557 aa AA seqDB search
MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTNGNPIPEEDKQ
RDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDVMKTHPCARVEAWVDPLNFQD
SKKAIEQIGKNLQAQYETLSLRTRYKQSLDPCVEDVKRFCNSLRRTSKEDRILFHYNGHG
VPKPTKSGEIWVFNRGYTQYIPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRI
KDDEEGNHDVAAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF
LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTPLGELNWIFTA
ITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMPWYNCHPVSDPELPDSITTHP
MWKSWDLAMDEVLTKIVIDLKNAPPATALESQMILQQQETLQNGGSSKSNAQDTKAGSIQ
TQSRFAVANLSTMSLVNNPALQSRKSISLQSSQQQLQQQQQQQQQFTGFFEQNLTAFELW
LKYASNVRHPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVLKL
LQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDWGVNGMSATNGSA
MINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHNNLPFYHSNDTTDEQKAMAVFVL
ASFVRNFPLGQKNCFSLELVNKLCFYIDNSEIPLLRQWCVILLGLLFADNPLNRFVCMNT
GAVEILLKSLKDPVPEVRTASIFALKHFISGFQDAEVILRLQQEFEEQYQQLHSQLQHLQ
NQSHLQQQQSQQQQQHLEQQQMKIEKQIRHCQVMQNQLEVIDLRKLKRQEIGNLISILPL
INDGSSLVRKELVVYFSHIVSRYSNFFIVVVFNDLLEEIKLLEKSDINTRNTSDKYSVSQ
GSIFYTVWKSLLILAEDPFLENKELSKQVIDYILLELSAHKELGGPFAVMEKFLLKRSSK
AHQTGKFGFNSSQVQFVKSSLRSFSPNERVDNNAFKKEQQQHDPKISHPMRTSLAKLFQS
LGFSESNSDSDTQSSNTSMKSHTSKKGPSGLYLLNGNNNIYPTAETPRFRKHTEPLQLPL
NSSFLDYSREYFQEPQMKKQEADEPGSVEYNARLWRRNRNETIIQETQGEKKLSIYGNWS
KKLISLNNKSQPKLMKFAQFEDQLITADDRSTITVFDWEKGKTLSKFSNGTPFGTKVTDL
KLINEDDSALLLTGSSDGVIKIYRDYQDVDTFKIVSAWRGLTDMLLTPRSTGLLTEWLQI
RGSLLTTGDVKVIRVWDAHTETVEVDIPAKTSSLITSLTADQLAGNIFVAGFADGSLRVY
DRRLDPRDSMIRRWRAGNDKQGVWINNVHLQRGGYRELVSGATNGVVELWDIRSEDPVES
FVDQNVTSQYGSQQKPTTMTCMQVHEHAPIIATGTKQIKIWTTSGDLLNSFKNSHNNGVT
STLAATGIPKSLSYSSTSDAFLSSMAFHPHRMMIAATNSHDSIVNIYKCEDERIDYF
NT seq 4674 nt NT seq  +upstreamnt  +downstreamnt
atgccggagatttatggacctcagccattaaagccactcaatacggtgatgagacatggg
tttgaagagcaataccaaagtgaccaacttttacaatcactcgcgaatgatttcatattc
tactttgatgataaacgacacaaaactaatggaaatccgattcctgaagaggataaacaa
cgagatgtaaatcgttattaccagccgattaccgattggaagattatgaaagatcgacag
aagacagtaagtgcggcccttttattatgcttgaatttaggtgtcgatccccctgatgtt
atgaagacacatccctgtgccagagttgaagcatgggtagacccattgaatttccaggac
tcgaagaaagcaatagaacaaattggtaaaaacttacaagcacagtacgaaactctgtct
ttgagaacacgctataaacaaagcttggatccttgtgtagaggatgtcaaacggttttgc
aactcgctaagaagaacttctaaggaagataggatacttttccactacaacggacatggt
gtgcctaagcctacaaaatcaggtgaaatttgggttttcaacagaggttatacacaatat
attccggtatctttgtatgacctgcaaacttggttaggtgcgccatgtatatttgtctat
gattgcaacagtgctgaaaatatattaatcaactttcagaagtttgtgcaaaagaggatt
aaagatgatgaagagggaaatcatgatgttgccgcgccatcaccaacttcagcttatcaa
gattgtttccaattagcctcttgcacttccgatgaacttttacttatgagtccggaacta
cccgcagatttgtttagttgttgtttgacctgtccaatagagattagcatccgtatcttt
ctcatgcagtcacccttaaaagattctaaatataaaattttcttcgaaaatagtacttca
aatcaaccgtttggtgatagtaagaactcgttcaagtccaaaatacccaacgtcaatatc
cctggaatgttgtcggataggagaacgccgttgggagaactaaattggatttttacagct
ataacggacacaattgcatggacatccctcccccgaccacttttcaaaaaattattcaga
catgatttaatgattgctgcgcttttcagaaattttcttctagccaaaagaataatgccg
tggtacaattgccatcctgtatctgatccagaattaccagatagtataaccacacatcca
atgtggaaatcttgggatttagccatggatgaagtactgactaaaatagtcattgatctg
aaaaatgctcctcccgctactgccttagagagtcagatgattctacaacaacaagaaacc
ttacagaatggtggcagctctaagtcgaatgcccaagatacgaaagccggaagtattcaa
acacaatcgagatttgcagtggccaatttaagtacaatgtctctagtaaataaccctgct
ctccaatcaagaaaatctatatctttgcaaagctcacagcaacaattacagcagcagcaa
caacaacaacaacaatttacaggattttttgaacaaaatttgactgcttttgaattgtgg
ttgaaatatgcttcaaatgtcagacacccgcctgagcagcttcctatcgttttacaggtt
cttctttcgcaagtgcatcgtatacgtgcgttggtacttttatccagatttttagattta
ggcccgtgggctgtctacctgtcactttcaataggtatcttcccctacgttttgaagctg
ctacaaagtccagcacctgagttgaagcccatcctagtttttatttgggcccgtatcatg
tcaatagattacaaaaacacgcaaagtgaattaatcaaagaaaagggttatatgtatttt
gttacagtgttagtacctgattggggtgttaatggcatgtcagctacaaatggctcagcc
atgataaatagtgggaacccgttgacaatgactgcatcgcagaatataaatggtccatct
tcaagatattatgaacgccagcaaggaaatagaacatccaacttgggccacaataatctt
ccattttatcattctaatgataccaccgatgaacaaaaagctatggctgtctttgttttg
gcatcattcgttcgaaactttcctctggggcaaaaaaattgttttagtttggaactggtc
aacaagttgtgcttttatattgataattctgagatacccctactaagacagtggtgtgtt
attttattaggtttattgtttgctgataaccccttaaacaggtttgtatgtatgaatact
ggtgctgttgaaatattactaaaatctttgaaggaccctgtacctgaagttagaacagct
tctatatttgcattgaagcatttcatatctggatttcaagatgcagaggtaattttgaga
ttgcaacaagaatttgaagaacagtatcagcaattacattcgcaattacagcatctccaa
aatcaatcccatctacaacaacaacagtcccagcaacagcagcagcatcttgagcagcag
cagatgaaaattgaaaagcagattcgtcattgtcaagttatgcaaaatcaactagaagtt
attgatttgaggaagttaaaaagacaggaaattggcaacttgatctcaatcttaccttta
atcaatgatggttcatcattagtccgtaaggaactagtcgtatatttttcgcatattgtg
agtcgttactctaacttttttattgtagttgtattcaatgatttgttggaagaaataaaa
cttttagagaaaagtgatatcaatactcgaaacacttccgataagtattcagttagtcag
ggttccattttctacactgtttggaaatctctcttgattctagccgaagatcccttttta
gagaacaaggaattatccaagcaggttatagattatattttgcttgaattaagcgcccat
aaggaacttggtggaccatttgcagttatggaaaaatttttgttgaaaagaagctcgaaa
gctcaccaaactggtaaatttggatttaattcttcgcaggttcaatttgtaaaaagttca
ttacgatcattctcaccaaatgagagggtagataataatgcattcaaaaaagagcaacaa
cagcatgacccaaagatatctcatccaatgcggacatctttagctaaacttttccagagt
cttggttttagcgaatccaatagtgactctgatactcaatcatcaaatacttcgatgaaa
tcgcatacctcaaaaaagggtccctcgggcttatatttattgaatggcaataataatatt
tatcctacagctgagactccaagattccggaagcatacagaacccttacaattgccatta
aatagttcctttttagactattcacgtgaatattttcaagaaccacaaatgaaaaagcaa
gaggcggatgaacctggcagtgttgagtataatgctagattgtggagacgtaacagaaat
gaaactattatccaggaaacacagggggagaaaaaattatcgatttatgggaattggtcc
aaaaaattgattagtttaaataacaaaagtcaaccaaaactgatgaagtttgcccagttt
gaagatcagctgattactgcagatgatagaagtaccattacagtttttgattgggagaaa
ggaaagactttgtccaaattctccaatggtactccttttggcacaaaagttactgacctg
aaactcattaacgaggatgactccgcccttttattgacaggttcttcagacggtgttatc
aaaatatacagagactaccaagatgtcgacacctttaaaattgtatccgcctggagaggc
ttgaccgatatgttattgacacctagatccacaggtttactaaccgaatggttacaaata
agaggatcattgttaacaactggtgatgttaaggttatccgtgtctgggatgcgcataca
gaaacggttgaagtggacattcctgcaaaaacatcatctttaattacatccttgacggct
gatcagctagcaggtaatatcttcgtagcagggtttgcagatggctccctgagagtatat
gatcgccgtctcgatccaagagattccatgatacgtcgctggagagctggaaatgataag
cagggagtttggattaacaatgttcatttacaaagaggtggttacagagaattggtcagt
ggagctaccaatggtgttgtagagttatgggatataaggtccgaagatccggtagaatcg
tttgttgatcaaaacgtaacttctcagtacggttcgcaacaaaaaccaacgacaatgacg
tgcatgcaggttcatgagcatgctccgataattgcgacagggactaaacaaataaagata
tggacgacatctggagatcttttgaattcttttaaaaactcacataataatggcgtaaca
agtacattagccgctacgggaatcccaaagtcactgtcctactcttccacttctgatgca
tttttatcttcgatggctttccatcctcatagaatgatgattgcggccaccaattctcac
gattctattgtaaatatctacaagtgtgaagacgagagaattgattatttttga

DBGET integrated database retrieval system