KEGG   Saccharomyces cerevisiae (budding yeast): YHR213WHelp
Entry
YHR213W           CDS       T00005                                 

Definition
hypothetical protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VIII:539151..539747
Genome map
AA seq 198 aa AA seqDB search
MTGYFLPPQTSSYTFRFAKVDDSAILSVGGNVAFECCAQEQPPITSTDFTINGIKPWQGS
LPDNIGGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDDFEGYVYSFDDDLS
QSNCTIPDPSKHTTSIVTTTTELWTGTFTSTSTEMTTVTGTNGQPTDETVIVAKAPTTAT
SSSLSSSSSEQITSSITS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgacaggttactttttaccaccacaaacaagttcttacacgttcaggtttgctaaggtc
gatgactctgcaattctatcagtcggtggtaacgttgcgttcgaatgttgtgcacaagaa
caacctccaattacatcgacggattttacaatcaatggtattaagccatggcaaggaagt
ttgcctgataacatcggagggactgtctacatgtatgcaggctactattatccgctgaag
gttgtttactccaatgccgtttcctggggcacgcttccaattagcgtggaattgcctgat
ggtactactgttagtgatgactttgaagggtacgtttactcttttgacgatgatttaagt
cagtcaaattgtactatccctgatccttcaaaacatactactagcatcgtcacaactact
accgaactgtggactggtacttttacttctacatctactgaaatgaccaccgtcaccggt
actaatggtcaaccaactgacgaaaccgttattgttgccaaagctccaaccactgccacc
tcatccagtttgtcatcatcttcttcagaacaaatcaccagctctatcacgtcttag

DBGET integrated database retrieval system