KEGG   Saccharomyces cerevisiae (budding yeast): YHR214C-DHelp
Entry
YHR214C-D         CDS       T00005                                 

Definition
hypothetical protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VIII:complement(550648..550941)
Genome map
AA seq 97 aa AA seqDB search
MEDHTLVAIVVFFGNGEPFHVSLSVEMVFVLLLSSTRIHEVVVLICYKLQHATWSWGNMS
KNFSLKPDISLSFLLDIISINDICIYGCIALTVVFIL
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atggaggaccacacccttgtggccatcgttgttttctttgggaatggtgaacctttccat
gtgtcgttgtctgtagaaatggtgttcgtgctgcttctttcatccactagaattcatgag
gtagtagttcttatatgttataaacttcaacacgccacctggtcttggggtaatatgagc
aagaatttctctcttaaaccggatataagtctgagctttctgttggatataatttctata
aatgatatatgcatctacggttgcattgcccttacagttgtgtttattttataa

  All links  
No link information was found.   
DBGET integrated database retrieval system