KEGG   Saccharomyces cerevisiae (budding yeast): YIL005WHelp
Entry
YIL005W           CDS       T00005                                 

Gene name
EPS1
Definition
protein disulfide isomerase EPS1 (EC:5.3.4.1)
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:sce04141]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IX:345692..347797
Genome map
AA seq 701 aa AA seqDB search
MKMNLKRLVVTFFSCITFLLKFTIAAAEPPEGFPEPLNPTNFKEELSKGLHIIDFYSPYC
PHCKHLAPVWMETWEEFKEESKTLNITFSQVNCIESADLCGDENIEYFPEIRLYNPSGYI
KSFTETPRTKESLIAFARRESMDPNNLDTDLDSAKSESQYLEGFDFLELIAGKATRPHLV
SFWPTKDMKNSDDSLEFKNCDKCHEFQRTWKIISRQLAVDDINTGHVNCESNPTICEELG
FGDLVKITNHRADREPKVALVLPNKTSNNLFDYPNGYSAKSDGYVDFARRTFTNSKFPNI
TEGELEKKANRDIDFLQERGRVTNNDIHLVFSYDPETVVIEDFDILEYLIEPLSKIPNIY
LHQIDKNLINLSRNLFGRMYEKINYDASQTQKVFNKEYFTMNTVTQLPTFFMFKDGDPIS
YVFPGYSTTEMRNIDAIMDWVKKYSNPLVTEVDSSNLKKLISFQTKSYSDLAIQLISSTD
HKHIKGSNKLIKNLLLASWEYEHIRMENNFEEINERRARKADGIKKIKEKKAPANKIVDK
MREEIPHMDQKKLLLGYLDISKEKNFFRKYGITGEYKIGDVIIIDKSNNYYYNKDNFGNS
LTSNNPQLLREAFVSLNIPSKALYSSKLKGRLINSPFHNVLSFLDIIHGNGMPGYLIVIV
LFIAILKGPSIYRRYKVRKHYRAKRNAVGILGNMEKKKNQD
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgaatctgaaaaggctcgtagttaccttcttctcatgcatcacctttctgctg
aaattcactatagccgccgctgaaccaccagagggctttccagagcccttaaatccaaca
aacttcaaagaagagctatctaaggggctgcatattattgacttctatagtccatactgt
ccgcactgcaaacatttagcacctgtttggatggaaacatgggaggagtttaaagaggag
agcaaaacactgaacataacattttcacaggttaactgcatcgagagcgccgatttgtgt
ggagatgaaaatattgaatacttccctgaaattagactttataacccctcaggatacatc
aaatcgttcactgaaacaccgaggaccaaagaatcattaattgcatttgcacgcagggag
tctatggacccaaataacctcgatactgatctggattctgctaaaagtgagagccagtat
ctcgaaggctttgattttctcgagctgatcgctggtaaggcgactaggccacatttggtt
tccttctggccaacaaaagatatgaaaaatagcgatgattcactagaattcaaaaactgt
gacaaatgccatgaattccaaaggacttggaagatcatttcaagacagttagccgtggat
gatatcaacacgggccacgttaattgcgaatctaatccaacaatctgtgaagaactgggc
tttggcgacttggtgaaaataaccaaccacagagccgatagagaacccaaggtagcatta
gtcctacccaataaaacctcaaataatttgttcgactatcccaatggctactcagcgaag
tcagatggctatgtagattttgccaggaggacttttacaaacagtaaatttcccaatata
acagaaggggagctcgaaaaaaaagcaaacagagacattgattttctgcaagaaagggga
cgagtaactaataatgatatccatttagttttttcatatgaccccgaaactgttgttatt
gaagattttgacattttggagtatttaatcgagcctttgtcaaaaattccaaacatatat
ttgcaccaaattgacaagaatctaataaatttgtcacgtaatctttttggaagaatgtat
gaaaagatcaactacgacgccagccaaactcaaaaggtttttaacaaagaatactttact
atgaatacggttacgcaactcccaacttttttcatgtttaaagatggtgatcccatatcc
tatgttttccccggatactccacaacagaaatgagaaatattgatgccattatggattgg
gtaaaaaagtattctaatcccttagttaccgaagttgactcttctaatttgaaaaaatta
atttccttccaaaccaagagctacagtgatttagcaattcagttaataagtagcactgac
cacaaacatatcaaaggaagcaacaagcttattaaaaacttgctcctcgcaagttgggag
tatgaacatattcggatggaaaataacttcgaagaaattaatgagagaagggcaaggaaa
gcagacgggatcaagaaaataaaggaaaaaaaggctccggctaacaaaattgttgataaa
atgcgtgaagagattccccatatggatcaaaaaaaattgttattaggatatttagatatt
tcaaaggagaagaatttttttagaaaatatggtattactggagaatataaaattggtgat
gtgattatcattgataaatcaaataattactactacaataaagataattttggcaactcc
ttgacttctaacaaccctcaattgctgagagaagcattcgtgtccttaaatattccatca
aaagctctatacagctctaagttgaaggggagattgataaattctccattccataatgtc
ctcagtttcctagacataatccacgggaacggcatgcccggttacttaattgttattgtt
ttgtttatcgcaatactcaaaggtccatctatttacagaagatacaaagtaaggaaacac
tatagggcgaaaaggaacgctgtcggtatcctaggaaatatggagaaaaaaaaaaatcaa
gattaa

DBGET integrated database retrieval system