KEGG   Saccharomyces cerevisiae (budding yeast): YIL026CHelp
Entry
YIL026C           CDS       T00005                                 

Gene name
IRR1, SCC3
Definition
Irr1p
Orthology
K06671  
cohesin complex subunit SA-1/2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YIL026C (IRR1)
   04113 Meiosis - yeast
    YIL026C (IRR1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IX:complement(304477..307929)
Genome map
AA seq 1150 aa AA seqDB search
MTAVRRSTRIRTKSQVIEEDYDDEQNTSAQHVESDKITAKTQHEEEEEQDTGESEESSSE
DDYEDQDDDDYVDTATAKRKSRKRKPKSASNTSSKRQKKKPTSAQKSAVSHAPAYHRSKK
DQDQYLEIAKDFQPTELFDILSTSEDVSIEELLREWLETYSENRDKFLQEFINLLLNCCG
SVARVEDHDVHSNESSNETIGEIQLLFQRQKLHEFYLLISKENKKRKNFKMGPLYQNFAE
FMTKLLEVANDLQLLYVESDEDDTQIVTGNLVLDLLTWLSSFSVCKIRCFRYISTLTLYL
FQDYLTQQAVNLEKNYLAKLSKQLSLEEKKKRPNNKTLEKLESTIAETQGSKVVIDSIID
NIVKLCFVHRYKDVSDLIRSESMLHLSIWIKNYPEYFLKVTFLKYFGWLLSDNSVSVRLQ
VTKILPHLIIQNHNSKSTDNSAIRQVFERFKTKILEVAIRDVNLDVRIHSIQVLTEASSL
GYLDDSEILIISSLMFDEEFDPFKTSSFNKRSKFLSTVAKFLARVIKEKFDEFIKTHEDL
PKEVDGLEVGPVVQVGIFIKILNDSLIYHLKDCAEVDSRTKIRMLTQAAEFLSPYISTHL
KTICNLLISDTESNELIQKLQNSANNNSDDEDVDDEELDITPLFPIDRNSTILYLNVFHG
LCAGANNPKIQTKDSVKEIVLPLFYDLLNAASIESADILCPLLESFITFSLDDWISIGYE
TELKKITDKTIKAFMDSTIGNSKVDMKYDIFAKFIHHIHHFEKKELQEKFLNQIATLKIH
LKKFLQEKMDPNNSRDDYKDLTCSLYELYINKLTILGRDYPIEVDEELLQLFLNNFVSRI
PIMFQDFDDSTAQEINFKMLVLLATWNLEKWREIIEKVRDYENSISKDLRSVWKPIAAII
GRLNTLVISLAATNETFENINSLFYLKWSACTSLMDIIVAIKIFELKLPADATTWRYSMS
EQFPFYLHDNASKVLLKIFLYLESLFAKQVDVQLERVADEDANLNDLPETGFFENIETEF
LLFTVKLKGLMKLNILDERFASRVALNKEKLGPLFKKIVDDTIMENPEPNKKNIQKAKSN
QTQREKAPLQPNSERETDHANTENNDPDIPMTIDLEPIEESSQNNSELAPIEEHPTVVDA
IDNSDEITQD
NT seq 3453 nt NT seq  +upstreamnt  +downstreamnt
atgactgctgtgcgtcgctcaactagaataaggactaaatctcaagttattgaggaagat
tacgatgacgagcaaaacaccagcgcacaacacgtagaatctgataagatcactgccaaa
acgcaacatgaagaagaagaagagcaagatactggtgaaagtgaagaaagtagtagtgag
gatgactatgaagaccaggatgatgatgactacgtagataccgctacggcaaagagaaag
tctagaaagagaaagcccaaatcagcatcaaataccagtagtaaaaggcagaagaaaaaa
cctacttctgcccagaagtcggcggtatctcatgcgcctgcttatcaccgctctaaaaaa
gatcaggatcaatacttagaaattgcgaaggatttccaacctacagaattgtttgatata
ttatccacttcagaagatgtttctattgaagaactattgcgagaatggttagaaacctat
tctgaaaatagagataaatttttacaagaatttatcaatttgctattgaattgttgtggc
tccgtcgctcgcgtcgaagaccacgacgttcacagcaatgaatcttctaacgaaacgatt
ggtgaaattcagttgctatttcaaagacagaaactgcacgaattttacctcttgattagc
aaggaaaacaaaaagagaaaaaactttaaaatgggtcccctttatcaaaatttcgcggaa
ttcatgactaaattgttggaagtggcaaatgacttacaattactatacgtggaatcggac
gaagatgatacccaaatagttactggtaatcttgtgttggatttgttgacttggctgtct
tctttttcagtttgcaaaatcagatgcttcagatacatttctacgctaacgctatatctt
ttccaggactatttgacccaacaggctgttaatttagaaaagaattatttggcgaagtta
tccaagcagttatcactagaagagaagaaaaaaaggcccaataacaagactttagaaaag
ctagagagcactatcgccgaaactcaaggcagcaaagtcgttattgatagcattatcgat
aacatcgtcaaactatgttttgtgcataggtataaggacgtgtctgatttgattcgttca
gaatccatgttgcatctatccatctggattaaaaactatcccgaatatttcctcaaggtt
acatttttaaaatattttggctggctgctgagcgataactctgtatcagtcagattacaa
gttacgaagattttaccgcatttaataatccaaaatcataacagtaaatccactgataat
tccgctatacgccaagtatttgaacgcttcaaaactaagatcctggaagtggcaatccgt
gacgttaatcttgatgtaaggatccatagtatccaagttctaacggaggcgtcatcattg
ggctatttagatgattctgagattcttatcatttctagtttaatgttcgatgaagagttc
gacccatttaaaacatcctcattcaataaaagatccaaatttctatccacggtggccaaa
ttcttagcaagagtaataaaagagaaatttgacgaattcatcaagacgcatgaagacttg
cccaaagaagtcgacgggttagaagttggacccgttgttcaagtcggtatatttatcaag
attctgaatgactctttaatttatcacttgaaggattgcgctgaagttgattcaaggaca
aagatccgtatgctaacacaagcagcagagtttttgtctccttacatttccactcacttg
aaaactatttgcaatctgctgatctctgacactgaatcaaatgaactgatccaaaagtta
caaaactcggccaataataacagcgatgacgaggatgttgacgatgaggaattggacatc
actccattgtttcccattgacagaaatagcactattttatatctgaacgtattccacggt
ctgtgtgcaggtgccaacaaccccaaaatccaaactaaggacagcgttaaggaaatagtt
ttgcctttattctacgatttgttgaatgccgcatccatcgaatctgctgatattctgtgt
cctctcctagagagctttatcacattttctctggatgattggatatctattggatatgaa
actgaattaaaaaaaattaccgacaaaactattaaagcatttatggattctacaatcggg
aattcaaaagttgacatgaagtacgatatatttgctaaattcattcaccatatccatcat
tttgaaaaaaaggaactgcaggaaaaatttttaaaccagatagctacattgaaaattcat
ttaaaaaaatttctacaggaaaaaatggatccaaataattctagggacgactacaaagat
ttaacttgttctttgtacgagctctacatcaataaactgacaattcttggcagggattac
ccaatcgaggttgatgaagagttgttgcaactgtttttgaacaattttgtttcccgtatc
cctataatgtttcaagattttgatgatagtaccgctcaagaaataaactttaaaatgcta
gtgttattagccacatggaatctggaaaaatggagagaaataatagagaaagtaagggat
tacgagaattctatttcaaaagatcttagatcagtttggaaaccaattgccgctataata
ggtcgtctaaacacactcgttatttcattggcggctacaaacgaaacatttgaaaacata
aacagcttgttttacttaaaatggtcagcttgcacttcattaatggatataatcgttgca
ataaaaatatttgagctcaaattgcctgcagacgctacaacatggagatatagtatgagt
gaacaatttccattttaccttcacgataatgcttccaaagtgcttttgaaaatattttta
tatttggagagtcttttcgctaagcaagttgacgtccaattagaaagggtagcagatgaa
gacgccaacctaaatgatttgccggaaaccgggtttttcgagaatattgaaactgaattc
cttttattcacagttaaattgaagggactaatgaaactgaatattttagatgaacgattt
gcttcccgtgtggcactaaacaaagaaaagcttggcccgctgttcaaaaaaatcgtagat
gataccataatggaaaatccagaacctaataaaaagaacatacagaaagcaaaatcaaat
caaacacagagggaaaaagcgcctttacaacccaacagtgaacgagaaaccgaccatgca
aatactgaaaataatgatccagatattcccatgacaatcgatctagaacctattgaagaa
agttcgcaaaataattcagagttagcaccaattgaggaacacccaaccgtggtagatgct
atagacaacagcgacgaaatcacacaagattaa

DBGET integrated database retrieval system