KEGG   Saccharomyces cerevisiae (budding yeast): YIL043CHelp
Entry
YIL043C           CDS       T00005                                 

Gene name
CBR1, CBR5
Definition
Cbr1p (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sce00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IX:complement(274072..274926)
Genome map
AA seq 284 aa AA seqDB search
MAIDAQKLVVVIVIVVVPLLFKFIIGPKTKPVLDPKRNDFQSFPLVEKTILTHNTSMYKF
GLPHADDVLGLPIGQHIVIKANINGKDITRSYTPTSLDGDTKGNFELLVKSYPTGNVSKM
IGELKIGDSIQIKGPRGNYHYERNCRSHLGMIAGGTGIAPMYQIMKAIAMDPHDTTKVSL
VFGNVHEEDILLKKELEALVAMKPSQFKIVYYLDSPDREDWTGGVGYITKDVIKEHLPAA
TMDNVQILICGPPAMVASVRRSTVDLGFRRSKPLSKMEDQVFVF
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggctattgatgctcaaaagcttgtggtggtcatcgtgatcgtggtcgtgcctttgctc
ttcaagttcattatcggaccgaagaccaagcctgtgctggatcccaaaaggaatgacttc
caatcatttccgctggttgaaaaaaccatcttaacgcataatacttcgatgtacaagttc
gggctacctcatgctgacgacgtactcggtttaccaattggtcagcatatcgtaattaag
gccaatatcaatggtaaggatattaccagatcgtatacgcccacatcgttggatggagat
acaaagggaaactttgaattactagtgaagtcttaccccacaggtaacgtttctaagatg
attggagagttgaagataggtgactcgatccagatcaagggccctcgtgggaactatcat
tatgagagaaactgccgttcccatctagggatgattgctggtggtactggtattgcgccc
atgtatcagatcatgaaagctattgccatggaccctcacgacactaccaaggtctctcta
gtctttgggaacgtccatgaggaggatattctgttgaagaaggaactggaagcgttggtg
gccatgaagccttcccaatttaagatagtttactacttagactctcctgaccgtgaagac
tggactggtggtgtaggatacattaccaaggatgtcatcaaggaacacttgcccgctgct
acaatggacaacgttcaaattttgatctgtggtcctccagccatggttgcctcagttaga
agaagtaccgtggacttggggttcagacgttccaaaccgctttccaagatggaagaccag
gtgtttgtgttttaa

DBGET integrated database retrieval system