KEGG   Saccharomyces cerevisiae (budding yeast): YIL046WHelp
Entry
YIL046W           CDS       T00005                                 

Gene name
MET30, ZRG11
Definition
Met30p
Orthology
K10259  
F-box and WD-40 domain protein MET30
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Ubiquitin mediated proteolysis
Module
SCF-MET30 complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:sce04120]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:sce04111]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IX:268651..270573
Genome map
AA seq 640 aa AA seqDB search
MRRERQRMMSFEDKDKDDLDNSNSNNSSEMTDTAMMPPLKRLLITGSSDDLAQGSSGKKK
MTMATRSPSSSPDLATNDSGTRVQPLPEYNFTKFCYRHNPDIQFSPTHTACYKQDLKRTQ
EINANIAKLPLQEQSDIHHIISKYSNSNDKIRKLILDGILSTSCFPQLSYISSLVTHMIK
IDFISILPQELSLKILSYLDCQSLCNATRVCRKWQKLADDDRVWYHMCEQHIDRKCPNCG
WGLPLLHMKRARIQQNSTGSSSNADIQTQTTRPWKVIYRERFKVESNWRKGHCRIQEFKG
HMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSL
DKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGH
TEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENL
ATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVK
TGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDLQSGKCMHTFNGRRLQRETQHT
QTQSLGDKVAPIACVCIGDSECFSGDEFGCVKMYKFDLND
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgaggagagagaggcaaaggatgatgagtttcgaggacaaggacaaggacgaccttgac
aatagtaatagtaataacagcagtgaaatgacagatacggcgatgatgccaccattaaag
agattgcttattacgggcagtagcgatgatttggcacaaggatcatcgggtaagaagaag
atgacgatggcgacgaggtcgccatcgtcatcacccgatttggcgacaaacgacagcggc
actagggtacagccattgccagaatataacttcaccaagttctgctatcggcataacccg
gacattcagttctcaccaactcatacagcgtgctacaagcaggatttgaaacgaacgcaa
gagattaatgctaatatcgcgaagctacccctgcaggagcaatccgacatccaccacatt
atctcgaagtacagcaattccaatgacaagatacggaagctgattctggatgggatccta
tcgacgagttgcttcccacagctttcctacatttcgtcactcgttacacacatgatcaag
atcgacttcatcagcattctgccgcaggagctgtcgctgaagatcttgagttatctggat
tgccaatctctttgcaacgccacgagagtgtgccgcaagtggcagaagctcgcggatgac
gacagggtatggtaccacatgtgcgagcagcacatagacaggaaatgtcccaactgtggc
tgggggctgcctcttttgcacatgaaacgtgcgcggatacaacagaatagtacaggatct
agcagcaacgcagatatccagacgcaaactacgcgaccttggaaagtcatctacagagaa
cggttcaaagtggagtcaaactggagaaagggccactgcaggattcaggaattcaagggc
cacatggatggtgtgttaacgctccagtttaactacaggcttttgttcacaggctcgtac
gactccaccataggtatatgggacttattcacggggaagctaatacgaaggctcagcggc
cattcggacggcgtcaagacattatattttgacgatagaaagctgattacgggctcgctc
gacaagacgatccgtgtttggaactacataaccggtgaatgcatttccacgtatcgaggc
cactcggatagcgttctgagcgtagattcataccagaaggttatcgtttccggcagtgct
gacaagacggtcaaggtatggcacgtggagtccaggacatgctacaccttgagaggccac
acggaatgggttaattgcgtcaaattgcatccgaaaagcttttcatgttttagttgcagt
gacgataccacaatccgaatgtgggatatcaggaccaattcatgcctaaaagtgttcagg
ggtcatgtagggcaggtgcaaaagatcataccgcttaccattaaggatgtagagaatcta
gccaccgacaacacttctgatggcagctctccgcaggatgacccaacaatgactgatggt
gcagacgaatcagacacaccgtcgaacgagcaagaaactgtcttagatgaaaacatacct
tatccaacacatctactatcttgcggactggataacacaatcaaactatgggacgtcaaa
accggtaaatgcataagaacacagtttgggcacgtggaaggtgtttgggacatcgccgct
gacaacttcagaattataagtggttctcacgacggaagcattaaggtctgggacttgcaa
agcgggaagtgtatgcacacgttcaacggtcgaagactacaaagagaaactcagcacaca
caaacacaatccttgggtgataaagtcgcccctatcgcttgtgtttgtattggagattca
gaatgctttagtggtgatgaatttgggtgcgtaaaaatgtacaaattcgatctcaatgat
tag

DBGET integrated database retrieval system