KEGG   Saccharomyces cerevisiae (budding yeast): YIL049WHelp
Entry
YIL049W           CDS       T00005                                 

Gene name
DFG10
Definition
Dfg10p (EC:1.3.1.94)
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     YIL049W (DFG10)
    1.3.1.94  polyprenol reductase
     YIL049W (DFG10)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IX:260158..260919
Genome map
AA seq 253 aa AA seqDB search
MYFDEEQLLKYTIYAYRLSFFVGICSLFIAKSCLPEFLQYGKTYRPKENSKYSSILERIK
KFTVPKAYFSHFYYLATFLSLVTLYFYPKFPIVWIIFGHSLRRLYETLYVLHYTSNSRMN
WSHYLVGIWFYSVLLLILNISLYKNSIPNTLNMNAFIIFCIASWDQYKNHVILANLVKYS
LPTGRLFRLVCCPHYLDEIIIYSTLLPYEQEFYLTLVWVITSLTISALETKNYYRHKFKD
NHVAPYAIIPFII
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtactttgatgaagaacaattgctaaaatatactatatatgcctatagattatccttt
tttgtaggcatttgctcacttttcatagcaaaaagttgtctaccagaatttcttcaatat
ggtaaaacctaccggcccaaagagaattcaaagtactcaagcattttagaacgaatcaag
aagttcacagttccaaaggcgtatttttcccatttttactatttggctacctttctatcc
ttagtcaccttatatttctatcctaaattccccatcgtttggatcatatttggacactca
ttgcgccgactttatgaaacgctttatgtactacattatacaagcaattctaggatgaat
tggtcccattatctagtcggtatatggttctattccgtactcttgttaattcttaatata
tcactgtacaagaactccattccaaatacgttaaacatgaatgctttcatcatattctgc
atagcatcttgggatcagtacaaaaatcatgttattctggccaatctggttaaatattcg
ctgccaacaggaaggcttttcaggttggtatgctgtcctcattatctcgatgaaataatc
atttattctactctgttgccctatgaacaagaattttacctaacactagtttgggtaatc
acaagtttgactatatccgcattggaaacaaaaaattattacaggcacaaatttaaagac
aatcacgtagccccctacgccataataccttttataatctag

DBGET integrated database retrieval system