KEGG   Saccharomyces cerevisiae (budding yeast): YIL082W-AHelp
Entry
YIL082W-A         CDS       T00005                                 

Definition
(RefSeq) gag-pol fusion protein
  KO
K07497  putative transposase
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_A2B RVT_1 rve Retrotrans_gag Asp_protease_2 gag-asp_proteas Asp_protease zf-H2C2 zf-CCHC DUF4939 RVP_2 DUF1758
Motif
Other DBs
NCBI-GeneID: 854728
NCBI-ProteinID: NP_012184
SGD: S000003537
UniProt: Q7LHG5
Position
IX:join(205635..206485,206487..210132)
Genome map
AA seq 1498 aa AA seqDB search
MSFMDQIPGGGNYPKLPVECLPNFPIQPSLTFRGRNDSHKLKNFISEIMLNMSMISWPND
ASRIVYCRRHLLNPAAQWANDFVQEQGILEITFDTFIQGLYQHFYKPPDINKIFNAITQL
SEAKLGIERLNQRFRKIWDRMPPDFMTEKAAIMTYTRLLTKETYNIVRMHKPETLKDAME
EAYQTTALTERFFPGFELDADGDTIIGATTHLQEEYDSDYDSEDNLTQNRYVHTVRTRRS
YNKPMSNHRNRRNNNASREECIKNRLCFYCKKEGHRLNECRARKRVLTDLELESKDQQTL
FIKTLPIVHYIAIPEMDNTAEKTIKIQNTKVKTLFDSGSPTSFIRRDIVELLKYEIYETP
PLRFRGFVATKSAVTSEAVTIDLKINDLQITLAAYILDNMDYQLLIGNPILRRYPKILHT
VLNTRESPDSLKPKTYRSETVNNVRTYSAGNRGNPRNIKLSFAPTILEATDPKSAGNRGN
PRNTKLSLAPTILEATDPKSAGNRGDSRTKTLSLATTTPAAIDPLTTLDNPGSTQSTFAQ
FPIPEEASILEEDGKYSNVVSTIQSVEPNATDHSNKDTFCTLPVWLQQKYREIIRNDLPP
RPADINNIPVKHDIEIKPGARLPRLQPYHVTEKNEQEINKIVQKLLDNKFIVPSKSPCSS
PVVLVPKKDGTFRLCVDYRTLNKATISDPFPLPRIDNLLSRIGNAQIFTTLDLHSGYHQI
PMEPKDRYKTAFVTPSGKYEYTVMPFGLVNAPSTFARYMADTFRDLRFVNVYLDDILIFS
ESPEEHWKHLDTVLERLKNENLIVKKKKCKFASEETEFLGYSIGIQKIAPLQHKCAAIRD
FPTPKTVKQAQRFLGMINYYRRFIPNCSKIAQPIQLFICDKSQWTEKQDKAIEKLKAALC
NSPVLVPFNNKANYRLTTDASKDGIGAVLEEVDNKNKLVGVVGYFSKSLESAQKNYPAGE
LELLGIIKALHHFRYMLHGKHFTLRTDHISLLSLQNKNEPARRVQRWLDDLATYDFTLEY
LAGPKNVVADAISRAIYTITPETSRPIDTESWKSYYKSDPLCSAVLIHMKELTQHNVTPE
DMSAFRSYQKKLELSETFRKNYSLEDEMIYYQDRLVVPIKQQNAVMRLYHDHTLFGGHFG
VTVTLAKISPIYYWPKLQHSIIQYIRTCVQCQLIKSHRPRLHGLLQPLPIAEGRWLDISM
DFVTGLPPTSNNLNMILVVVDRFSKRAHFIATRKTLDATQLIDLLFRYIFSYHGFPRTIT
SDRDVRMTADKYQELTKRLGIKSTMSSANHPQTDGQSERTIQTLNRLLRAYVSTNIQNWH
VYLPQIEFVYNSTPTRTLGKSPFEIDLGYLPNTPAIKSDDEVNARSFTAVELAKHLKALT
IQTKEQLEHAQIEMETNNNQRRKPLLLNIGDHVLVHRDAYFKKGAYMKVQQIYVGPFRVV
KKINDNAYELDLNSHKKKHRVINVQFLKSLYTVQTRTQRINQSAPLRELREHTKLLHS
NT seq 4497 nt NT seq  +upstreamnt  +downstreamnt
atgagctttatggatcaaatcccaggaggaggaaattatccaaaactcccagtagaatgc
cttcctaacttcccgatccaaccatctttgaccttcagaggtagaaatgactcgcataaa
ctgaaaaactttatctccgaaataatgctaaacatgtctatgatatcttggccgaatgat
gccagtcgtattgtgtactgcagaagacatttattaaaccccgctgctcagtgggctaat
gattttgtacaagaacaaggtatacttgaaataacattcgacacattcatacaaggatta
tatcaacatttctataagccaccagatatcaataaaatctttaatgcaatcacgcaactt
tccgaagctaaacttggtattgagcgtctcaaccaacgattcagaaagatttgggacaga
atgccaccagacttcatgaccgaaaaagctgccataatgacatatactaggctattgaca
aaggaaacctataatattgtcagaatgcacaaaccagagacattaaaagacgccatggaa
gaggcttaccagacaaccgcactaactgaaagattcttcccaggattcgaacttgatgct
gatggagacactatcatcggtgccacaacccacttacaagaagaatacgactctgactat
gattcagaagataatctgacccagaatagatacgtccacaccgtaaggacaagaagatct
tacaataaaccaatgtcaaatcatcgaaacaggagaaataacaacgcatccagagaagaa
tgtataaaaaatcggctatgcttctattgtaagaaagagggacatcgcctgaacgaatgt
agagcacgtaagcgagttctaaccgatcttgaactcgaatcaaaagaccaacaaactctt
tttatcaaaaccttaccaattgtacactatatcgccatccccgagatggacaataccgcc
gaaaaaaccataaaaatacaaaacacgaaagtaaaaaccctgtttgacagtggatcaccc
acgtcatttatccgaagagatattgtagaacttctcaaatacgaaatctacgagacccct
ccactccgttttagaggattcgtagccaccaaatccgccgttacatccgaagcagtcacc
attgacctcaaaatcaatgacctgcagataactttagccgcgtacatactggataacatg
gactaccaattgttaattggaaatccaatcttacgccgctacccgaaaatcctgcacaca
gtactgaataccagagagagccccgactccttaaagcccaagacttatcgctccgaaacc
gttaataacgttagaacctactccgctggtaatcgtggtaaccccagaaacataaaactg
tcttttgcccccaccattctcgaagcaactgacccgaaatccgctggtaatcgtggtaac
cccagaaacacaaaactgtctcttgcccccaccattctcgaagcaactgacccgaaatcc
gctggtaatcgtggtgactccagaaccaaaaccctgtctcttgcaaccactactcctgca
gcaattgacccgcttacgacccttgataacccaggtagtactcaaagtacatttgcgcaa
ttcccgatacctgaagaagcgagcatcctagaagaggatggaaaatactccaacgttgtc
tcaaccattcagagtgtagaacctaatgctactgatcacagcaataaggacaccttttgc
actttgccagtttggttacaacagaagtatagagagatcatacgtaatgatctcccacca
agacctgccgacattaacaacatccccgtaaaacatgatattgaaattaaacctggcgca
agactacctcgactacagccataccatgttacagaaaagaatgaacaagaaatcaacaaa
atagttcaaaaactgctcgataacaagttcattgttccctcaaagtcgccctgcagctcc
cctgtagtcctcgtcccgaagaaagacggtaccttccgactctgcgtcgattaccgcacc
ctgaacaaagctaccatctccgacccattcccattacccagaatcgacaacctattgagc
cgtattggaaatgcccagatatttaccacgctagatttgcatagtggttaccaccagatc
ccgatggaacccaaagaccgctacaaaaccgcctttgtcaccccatccggtaagtatgaa
tataccgtcatgccatttggcttagtcaatgcacctagtacattcgcaagatacatggct
gatacatttagagacctgagattcgtcaatgtttaccttgatgatatattaatcttctcc
gaatctccagaagaacattggaaacatttagacacggtactagaaagattaaagaacgag
aacctcattgttaagaagaaaaaatgtaaatttgcatctgaagaaactgagtttttaggc
tatagtattggaatccagaaaatagctccactacagcacaaatgtgcagcaatccgagac
tttccgacgcctaaaacagtaaaacaagcacagagatttttaggaatgattaattactac
agacgattcattccgaattgctccaagattgcacagccaatccaactgtttatttgtgac
aaaagtcaatggacagaaaaacaagacaaggcaattgagaaactaaaagccgccttgtgt
aactcccccgtcctagtaccattcaacaacaaagcaaactaccgacttacaacagacgcc
tcaaaagacggcattggtgctgttctagaagaagtcgacaacaagaacaaacttgttggt
gtcgtcggttacttctctaaatccttagagagtgcccagaaaaactatcctgctggcgaa
ttagaactacttggaattatcaaagcactccaccacttccgatatatgcttcacggaaag
catttcacgttaagaacagaccacattagtttgttatcattacaaaacaagaacgaaccc
gcacgacgcgtgcaacgctggttagatgacctagccacatatgacttcaccttagaatac
ttagctggacccaagaacgttgtcgcagatgccatatcccgtgccatatatactataacc
cccgaaacatcccgacctatcgacacagaaagctggaaatcttactacaaatcagaccca
ttatgtagtgctgtcttaattcatatgaaagaattgacacaacacaacgtcacacctgaa
gatatgtcagccttccgtagttaccagaagaaactcgaactatcagagaccttccgaaag
aattattccctagaagacgaaatgatctattaccaagaccgactagtagtaccaataaaa
caacagaacgcagttatgagactgtatcatgaccataccttatttggaggacatttcggt
gtaacagtgacccttgcgaaaatcagcccaatttactattggccgaaactacaacattcg
atcatacagtacatcaggacctgcgtacaatgtcaactaataaaatcacaccgtccacgc
ttacatggactattgcaaccactccccatagcagaaggaagatggcttgatatatcaatg
gattttgtgacaggattacccccaacatcaaataacttgaatatgatcctcgtcgtagtt
gatcgtttctcgaaacgcgctcacttcatagctacaaggaaaactttagacgcaacacaa
ctaatagatttactctttcgatacattttttcatatcatggttttcccaggacaataacc
agtgatagagatgtccgtatgaccgccgacaaataccaagaactcacgaaaagactagga
ataaaatcgacaatgtcttccgcgaaccacccccaaacagatggacaatccgaacgaacg
atacagacattaaacaggttactaagagcctatgtttcaaccaatattcagaattggcat
gtatatttaccacaaatcgaatttgtttacaactctacacctactagaacacttggaaaa
tcaccatttgaaattgatttaggatatttaccgaatacccctgctattaagtcagatgac
gaagtcaacgcaagaagttttactgccgtagaacttgccaaacacctcaaagcccttacc
atccaaacgaaggaacagctagaacacgctcaaatcgaaatggaaactaataacaatcaa
agacgtaaacccttattgttaaacataggagatcacgtattagtgcatagagatgcatac
ttcaagaaaggtgcttatatgaaagtacaacaaatatacgtcggaccatttcgagttgtt
aagaaaataaacgataacgcctacgaactagatttaaactctcacaagaaaaagcacaga
gttattaatgtacaattcctgaaaagtttgtataccgtccagacgcgtacccaaagaata
aaccaatcagctccactgagagaattaagagagcacacgaagttactgcactcatag

DBGET integrated database retrieval system