KEGG   Saccharomyces cerevisiae (budding yeast): YIL099WHelp
Entry
YIL099W           CDS       T00005                                 

Gene name
SGA1
Definition
glucan 1,4-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YIL099W (SGA1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     YIL099W (SGA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IX:178004..179653
Genome map
AA seq 549 aa AA seqDB search
MARQKMFYNKLLGMLSVGFGFAWALENITIYEFDFGKGILDQSYGGVFSNNGPSQVQLRD
AVLMNGTVVYDSNGAWDSSALEEWLQGQKKVSIEKIFENIGPSAVYPSISPGVVIASPSQ
THPDYFYQWIRDSALTINSIVSHSAGPAIETLLQYLNVSFHLQRSNNTLGAGIGYTNDTV
ALGDPKWNVDNTAFTEDWGRPQNDGPALRSIAILKIIDYIKQSGTDLGAKYPFQSTADIF
DDIVRWDLRFIIDHWNSSGFDLWEEVNGMHFFTLLVQLSAVDKSLSYFNASERSSPFVEE
LRQTRRDISKFLVDPANGFINGKYNYIVGTPMIADTLRSGLDISTLLAANTVHDAPSASH
LPFDINDPAVLNTLHHLMLHMRSIYPINDSSKNATGIALGRYPEDVYDGYGFGEGNPWVL
ATCTASTTLYQLIYRHISEQHDLVVPMNNDCSNAFWSELVFSNLTTLGNDEGYLILEFNT
PAFNQTIQKIFQLADSFLVKLKAHVGTDGELSEQFNKYTGFMQGAQHLTWSYTSFWDAYQ
IRQEVLQSL
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggcaagacaaaagatgttttataacaaattactcggcatgctcagcgtaggattcggg
tttgcttgggcgctcgagaacattactatatacgaatttgactttggcaagggcattctc
gatcaaagctacggcggtgtattttcaaacaacggcccttcgcaagtgcagctgcgggat
gcagtcttgatgaatgggacagtggtatacgattcaaacggcgcttgggacagtagtgcg
ctggaggaatggctccagggacagaaaaaagtttccatcgaaaaaatatttgaaaatatt
gggcccagcgccgtgtatccgtctatttcgcctggggtcgtgattgcgtcaccatcgcaa
acgcatccagactacttctaccaatggataagggacagcgcgttgacgataaacagtatt
gtctctcattctgcgggcccggcaatagagacgttattgcagtacctgaacgtttcattc
cacttgcaaagaagcaacaacacattgggcgctggcattggttacactaacgatacagtg
gctttgggagaccctaagtggaacgtcgacaacacggctttcacggaagattggggtcgt
cctcaaaacgatgggcctgctcttcgaagcattgccatcttaaaaatcatcgactacatc
aagcaatctggcactgatctgggggccaagtacccattccagtccaccgcagatatcttt
gatgatattgtacgttgggacctgaggttcattattgaccactggaattcttccggattt
gatctatgggaggaagtcaatggcatgcatttctttactttactggtacaactgtctgca
gtggacaagtcgctgtcgtattttaacgcctcagaacggtcgtctccctttgttgaagaa
ttgcgtcagacacgccgggacatctccaagtttttagtggaccctgcgaatgggtttatc
aacggcaagtacaattatattgttgggacacccatgattgccgacacattgagatccgga
ctggacatatccactttattagctgcgaacaccgtccacgatgcgccatctgcttcccat
cttccgttcgatatcaatgaccctgccgtcctgaacacgttgcaccatttgatgttgcac
atgcgttcgatataccccatcaacgatagctccaaaaatgcaacgggtattgccctgggc
cggtatcctgaggacgtatatgatggatatggctttggcgagggaaatccctgggtcctg
gccacgtgtaccgcttcaacaacgctttatcagctcatttacagacacatctctgagcag
catgacttggttgtcccaatgaacaacgattgttcgaacgcattttggagcgagctggta
ttctccaacctcacgactttgggaaatgacgaaggctatttgattttggagttcaataca
cctgccttcaatcaaaccatacaaaaaatcttccaactagctgattcattcttggtcaag
ctgaaagctcacgtgggaacagacggggaactaagtgaacaatttaacaaatacacaggg
tttatgcagggtgcccaacaccttacctggtcctatacttcattctgggatgcctatcaa
ataagacaagaagttttacagagtttgtag

DBGET integrated database retrieval system