KEGG   Saccharomyces cerevisiae (budding yeast): YIL106WHelp
Entry
YIL106W           CDS       T00005                                 

Gene name
MOB1
Definition
Mob1p
Orthology
K06685  
MOB kinase activator 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:sce04111]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
IX:join(166415..166434,166520..167444)
Genome map
AA seq 314 aa AA seqDB search
MSFLQNFHISPGQTIRSTRGFKWNTANAANNAGSVSPTKATPHNNTINGNNNNANTINNR
ADFTNNPVNGYNESDHGRMSPVLTTPKRHAPPPEQLQNVTDFNYTPSHQKPFLQPQAGTT
VTTHQDIKQIVEMTLGSEGVLNQAVKLPRGEDENEWLAVHCVDFYNQINMLYGSITEFCS
PQTCPRMIATNEYEYLWAFQKGQPPVSVSAPKYVECLMRWCQDQFDDESLFPSKVTGTFP
EGFIQRVIQPILRRLFRVYAHIYCHHFNEILELNLQTVLNTSFRHFCLFAQEFELLRPAD
FGPLLELVMELRDR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttctacaaaattttcatataagtcccggccaaacaataagatctactagaggt
ttcaagtggaatactgccaatgcagctaataatgcaggctctgtatcgcctactaaggca
actccccataacaatactattaacggcaataataataatgccaatactattaacaataga
gcagattttacaaacaatccagtaaacggatataatgaaagcgaccatggaaggatgtct
cccgtcctcactacgccaaagaggcacgcccctccgcctgaacaattacaaaatgtaacg
gactttaactatacaccatcgcatcagaagccgtttctacaaccgcaagcaggtacgaca
gttacaacacatcaagacatcaagcaaattgtggagatgacactggggtctgagggagtc
cttaaccaagctgtgaagttaccgcgtggtgaggatgagaatgaatggctagcggttcat
tgcgtggatttttacaatcagattaatatgttatacgggtccatcacagaattttgctcc
ccacaaacatgcccgaggatgatagcgacgaacgaatatgaatatctttgggcatttcaa
aagggtcagccccccgtttcggtaagtgcccctaagtatgtggaatgtttgatgaggtgg
tgtcaagaccaatttgatgacgaatctctttttccttccaaagtcaccggtaccttcccg
gagggattcatccaacgagtaattcaaccaattctaaggcgattattcagagtttatgcg
catatttactgtcatcattttaatgaaattcttgaactaaatttacaaaccgtactaaac
acaagttttagacatttttgtctttttgcacaagagttcgaactactaagaccggctgat
tttggtccgctgttagaattagtgatggagttgagggataggtag

DBGET integrated database retrieval system