KEGG   Saccharomyces cerevisiae (budding yeast): YIL156WHelp
Entry
YIL156W           CDS       T00005                                 

Gene name
UBP7
Definition
Ubp7p (EC:3.4.19.12)
Orthology
K11871  
ubiquitin carboxyl-terminal hydrolase 7/11 [EC:3.4.19.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Enzymes [BR:sce01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     YIL156W (UBP7)
Peptidases [BR:sce01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   YIL156W (UBP7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IX:48091..51306
Genome map
AA seq 1071 aa AA seqDB search
MLDDDKGTAMHPHITPFTPEYSNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLF
ELYLDSIHHDRPNDALTAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMT
NVVLMVKKEIGVVLDESVKHGAGIEHRITKKRAFSVPADDLSGQVASLSLDTAAPQDHGL
KGTFTEDDAEQSSPVWTAPNLEPNDQLKLALLPEVIPTPAFREPERKTSVPVRPSVLLED
VPSIYHEDDTSFASLNPPFREITADRSVTHRKDSYHSVYMVDSGNLKEDNDDLFNVENDG
FIQSLDILQKQSIITAPELFSILSNRVEREKVLLIDLRIPQRSAINHIVAPNLVNVDPNL
LWDKQTNTPIYKDDILEHLLKENENFINRNKFDYIVYYTDVKTFMTINFDYAFIFFYLML
TSQKTPLTTVPTTLLGGYEKWKKTLHSYAQEYHISIEDYLYRPYSQKARLQQEQQQQQQQ
PDSQDSFSAKESSTKVPEPPSWKPPDLPIRLRKRPPPPPPVSMPTTPEIPPPLPPKIMVH
SQVSSISRKPPIPAKQHVKKEQLNSNEIIQRKRQHQHQHYDQQILQPQRAYNIPTIERSP
NVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSKYKSYLQPIRSNGSHYSPKL
SNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELS
DQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRC
GYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPR
CGPTASVSTSVSALENEPSIVKSKKKKSRFFTLHTGTKRRHLDFFGDGITEGHNSNNNNT
TIFERERSRSPFRMLGGSGKRSSSSTPFSTGGNDSNNSSDYKNKKLTTVKTINFVTLPKI
LVIHLSRFYYDLTKKNNTVVTYPLILNIILKNNDTMKYKLFGVVNHTGTLISGHYTSLVN
KDLEHNVNIGRSKWYYFDDEVVKADRKHGSDKNLKISSSDVYVLFYERVYD
NT seq 3216 nt NT seq  +upstreamnt  +downstreamnt
atgctagacgatgataagggcacggccatgcatccacatataacgccgttcacgcctgag
tactcaaatgaattactgcgaagggtccaggacctgtaccacgaagatatcaagcactac
tatccgcagctaaaactggagaagctgctggaccttctggagcatacagagtacctattc
gagttatatctagattcaatccatcacgataggcccaacgatgcactgacagcgtttatc
attggatgctactacgtgttcttaattattccacaatctttgcagttccaaacacgaaac
aagtcctacagcatctatacagatctaaaaaagatgtatgagaatgaaatgaacatgacc
aatgttgtgcttatggtgaagaaagaaatcggtgtggtcctagatgaatcggttaaacac
ggggccggtattgagcacagaatcaccaagaagagggcattttcagttccagctgacgat
ctttcaggtcaggtagcttcactatcacttgacaccgcggcaccgcaagatcatggcctc
aaaggcacgtttactgaagacgacgcagaacaatcttcacctgtttggacagcaccaaac
ttagagcccaacgaccaattgaaactggctttattgcccgaagtgataccaacgccagct
tttcgtgagcctgaaagaaagacaagtgttccagtgagaccatctgttttattggaagat
gtaccctccatataccacgaggatgacactagtttcgcatctttgaacccaccatttcga
gaaataaccgcagatagatcagtaactcatcgaaaggattcttaccattctgtttatatg
gtggatagcggcaacctcaaggaagacaatgatgatctgttcaacgttgagaatgatggc
ttcatccagagtttggatattttacaaaagcagagtataatcacagcaccagaattgttt
agtattttatcgaatcgcgttgaacgtgaaaaggttttactcatcgacttgagaatacca
caaagatctgcaataaatcacattgtggctccgaacttagtgaatgtggatccaaacttg
ttgtgggacaagcagacgaacacacctatctacaaggatgacatattggaacatttactg
aaggagaatgagaattttataaaccgtaataaatttgattacattgtttactatactgat
gtgaagaccttcatgactataaattttgattatgcatttatttttttttatttgatgctg
acttctcagaagactcctttaacaactgtacctactaccctcttaggtgggtacgaaaaa
tggaagaaaactctgcattcgtatgcccaggagtatcatatctctattgaagattacttg
tacagaccttactcacagaaggcgcgcttacaacaggagcagcagcagcagcagcagcag
ccggattctcaggactctttttccgctaaggaatcatctacaaaagttcctgagcctccc
tcctggaagccccctgacctgcctataaggttaaggaaacgtcctccacctccaccgcct
gtatcaatgcccacaaccccagaaattccacctcctctgccccctaagataatggttcat
tcacaagtcagttctatctctcgaaagccgccaataccagcaaagcagcatgtcaaaaag
gaacaacttaactccaatgaaattattcaaagaaaaagacagcaccagcatcagcattac
gaccaacaaatattacaaccgcaaagggcgtacaatattccaactattgaacgcagtcca
aacgtatacgtttcgttgtccatcacgggactaagaaatttgggcaatacatgttacatt
aatagtatgatacaatgtctattcgctgcgaaaacattccggacactcttcatttcatcc
aaatataagagctatctgcaaccaataaggagcaacggatctcattattctcctaaactt
tcgaattcactaagtatgctcttcaacaagatgtatctaaatggtggttgctcagttgtc
ccaacaggatttctcaaagttatcaatcaattgcgtcccgatttgaaaattcctgatgac
caacaggatacccaagagttcctaatgatacttttagacaggttacacgatgaactttcc
gaccaacagcatgtagcgaacgattatccgaatttattattgtataatgcagatgcccta
aaggtttcaaacaacgaatataagcactggtttgacaaaaatgtcattggtaatggtata
tctcctattgatgacatttttcaagggcaaatggagaacagcttacaatgtaaaaggtgc
ggttacactactttcaactatagcacattttatgttttatcactggctataccaagacgt
tccatgaagttgagtaaacttggtaggtctactgagaaaagagttaagttagaggattgt
attaatatgtttacaagcgatgaggtactctctggtgaaaatgcatgggattgcccacgc
tgtggccccacggcgtctgtgtctacatctgtgtctgcattagagaatgagccatccatt
gttaagagtaaaaagaaaaaaagtcggttttttacattacatacaggaaccaagcgtcgt
catctcgacttttttggagacggtattactgagggccataatagcaataataataatacg
acaatctttgaacgagaaaggtccagatcacccttcaggatgttgggtggtagtgggaag
aggtccagttccagtacaccgttcagtactggtggtaatgatagtaacaactcgagtgat
tacaagaacaaaaaattgacaacagtgaaaacgataaattttgtaactttaccaaaaatc
ttagtcatccatttatcgagattttattacgatttgaccaagaaaaataacaccgtcgta
acatatccattgatactaaacattatattgaaaaacaatgacactatgaaatataagcta
tttggagtggttaaccatacaggcacattaatcagtggccattacacgtcactggtgaat
aaagaccttgaacacaatgtgaatattgggcgttctaaatggtactatttcgacgatgag
gttgtcaaggcagataggaaacatggatctgataaaaacttgaaaatttcaagtagcgat
gtctacgtattgttttatgaaagggtttatgactag

DBGET integrated database retrieval system