KEGG   Saccharomyces cerevisiae (budding yeast): YIL162WHelp
Entry
YIL162W           CDS       T00005                                 

Gene name
SUC2
Definition
beta-fructofuranosidase SUC2 (EC:3.2.1.26)
Orthology
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    YIL162W (SUC2)
   00500 Starch and sucrose metabolism
    YIL162W (SUC2)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     YIL162W (SUC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
IX:37385..38983
Genome map
AA seq 532 aa AA seqDB search
MLLQAFLFLLAGFAAKISASMTNETSDRPLVHFTPNKGWMNDPNGLWYDEKDAKWHLYFQ
YNPNDTVWGTPLFWGHATSDDLTNWEDQPIAIAPKRNDSGAFSGSMVVDYNNTSGFFNDT
IDPRQRCVAIWTYNTPESEEQYISYSLDGGYTFTEYQKNPVLAANSTQFRDPKVFWYEPS
QKWIMTAAKSQDYKIEIYSSDDLKSWKLESAFANEGFLGYQYECPGLIEVPTEQDPSKSY
WVMFISINPGAPAGGSFNQYFVGSFNGTHFEAFDNQSRVVDFGKDYYALQTFFNTDPTYG
SALGIAWASNWEYSAFVPTNPWRSSMSLVRKFSLNTEYQANPETELINLKAEPILNISNA
GPWSRFATNTTLTKANSYNVDLSNSTGTLEFELVYAVNTTQTISKSVFADLSLWFKGLED
PEEYLRMGFEVSASSFFLDRGNSKVKFVKENPYFTNRMSVNNQPFKSENDLSYYKVYGLL
DQNILELYFNDGDVVSTNTYFMTTGNALGSVNMTTGVDNLFYIDKFQVREVK
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgcttttgcaagctttccttttccttttggctggttttgcagccaaaatatctgcatca
atgacaaacgaaactagcgatagacctttggtccacttcacacccaacaagggctggatg
aatgacccaaatgggttgtggtacgatgaaaaagatgccaaatggcatctgtactttcaa
tacaacccaaatgacaccgtatggggtacgccattgttttggggccatgctacttccgat
gatttgactaattgggaagatcaacccattgctatcgctcccaagcgtaacgattcaggt
gctttctctggctccatggtggttgattacaacaacacgagtgggtttttcaatgatact
attgatccaagacaaagatgcgttgcgatttggacttataacactcctgaaagtgaagag
caatacattagctattctcttgatggtggttacacttttactgaataccaaaagaaccct
gttttagctgccaactccactcaattcagagatccaaaggtgttctggtatgaaccttct
caaaaatggattatgacggctgccaaatcacaagactacaaaattgaaatttactcctct
gatgacttgaagtcctggaagctagaatctgcatttgccaatgaaggtttcttaggctac
caatacgaatgtccaggtttgattgaagtcccaactgagcaagatccttccaaatcttat
tgggtcatgtttatttctatcaacccaggtgcacctgctggcggttccttcaaccaatat
tttgttggatccttcaatggtactcattttgaagcgtttgacaatcaatctagagtggta
gattttggtaaggactactatgccttgcaaactttcttcaacactgacccaacctacggt
tcagcattaggtattgcctgggcttcaaactgggagtacagtgcctttgtcccaactaac
ccatggagatcatccatgtctttggtccgcaagttttctttgaacactgaatatcaagct
aatccagagactgaattgatcaatttgaaagccgaaccaatattgaacattagtaatgct
ggtccctggtctcgttttgctactaacacaactctaactaaggccaattcttacaatgtc
gatttgagcaactcgactggtaccctagagtttgagttggtttacgctgttaacaccaca
caaaccatatccaaatccgtctttgccgacttatcactttggttcaagggtttagaagat
cctgaagaatatttgagaatgggttttgaagtcagtgcttcttccttctttttggaccgt
ggtaactctaaggtcaagtttgtcaaggagaacccatatttcacaaacagaatgtctgtc
aacaaccaaccattcaagtctgagaacgacctaagttactataaagtgtacggcctactg
gatcaaaacatcttggaattgtacttcaacgatggagatgtggtttctacaaatacctac
ttcatgaccaccggtaacgctctaggatctgtgaacatgaccactggtgtcgataatttg
ttctacattgacaagttccaagtaagggaagtaaaatag

DBGET integrated database retrieval system