KEGG   Saccharomyces cerevisiae (budding yeast): YIL172CHelp
Entry
YIL172C           CDS       T00005                                 

Gene name
IMA3
Definition
oligo-1,6-glucosidase IMA3 (EC:3.2.1.10)
Orthology
K01187  
alpha-glucosidase [EC:3.2.1.20]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    YIL172C (IMA3)
   00500 Starch and sucrose metabolism
    YIL172C (IMA3)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     YIL172C (IMA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IX:complement(16784..18553)
Genome map
AA seq 589 aa AA seqDB search
MTISSAHPETEPKWWKEATIYQIYPASFKDSNNDGWGDMKGIASKLEYIKELGTDAIWIS
PFYDSPQDDMGYDIANYEKVWPTYGTNEDCFALIEKTHKLGMKFITDLVINHCSSEHEWF
KESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWRSYFGGSAWTFDEKTQEFYLRLFCS
TQPDLNWENEDCRKAIYESAVGYWLDHGVDGFRIDVGSLYSKVAGLPDAPVIDENSKWQL
SDPFTMNGPRIHEFHQEMNKFIRNRVKDGREIMTVGEMRHATDETKRLYTSASRHELSEL
FNFSHTDVGTSPKFRQNLIPYELKDWKVALAELFRYVNGTDCWSTIYLENHDQPRSITRF
GDDSPKNRVISGKLLSVLLVSLSGTLYVYQGQELGEINFKNWPIEKYEDVEVRNNYDAIK
EEHGENSKEMKRFLEAIALISRDHARTPMQWSREEPNAGFSGPNAKPWFYLNESFREGIN
AEDESKDPNSVLNFWKEALRFRKAHKDITVYGYDFEFIDLDNKKLFSFTKKYDNKTLFAA
LNFSSDSIDFTIPNNSSSFKLEFGNYPRSEVDASSRTLKPWEGRIYISE
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgactatttcttctgcacatccagaaacagaacccaagtggtggaaagaggccacaatt
tatcaaatttatcccgcaagtttcaaagactccaacaacgatggttggggtgatatgaag
ggtattgcctccaagttggagtacatcaaagagcttggtaccgatgccatttggatctcg
ccattttacgactcgccacaagatgatatgggttacgatattgccaactacgaaaaggtc
tggccaacctacggtacgaacgaggactgctttgccttgatcgaaaagacacataagctt
ggtatgaaatttatcaccgacttagtcatcaaccattgctccagcgaacatgaatggttc
aaagagagcagatcctcaaaaaccaatccaaaacgtgactggttcttctggagacctcct
aagggttatgacgccgaaggcaagccaattcctccaaacaattggaggtcttacttcggt
ggttctgcatggacgttcgatgaaaagacacaagagttttacttgcgtttgttttgctcc
acccaacctgatctaaactgggagaacgaagactgcagaaaggcaatctacgaaagtgcc
gttggatactggttagaccatggtgtagacggctttagaattgatgtgggaagcttgtac
tccaaggttgctggtctaccagacgctcctgtgattgacgaaaactcaaagtggcaactc
agtgatcctttcacaatgaacggaccacgtatccatgagtttcatcaagaaatgaacaag
ttcatcagaaacagagtgaaggatggcagagaaattatgacagttggtgaaatgcgacat
gctactgatgagaccaagaggttgtatacaagtgcgtcaagacacgaacttagtgagtta
ttcaacttttcccacactgatgtcgggacttcgcccaagttccgtcaaaatttgatacca
tatgaactaaaggattggaaggttgcccttgctgaacttttcagatacgttaacggaact
gattgttggtcaacaatttatctggaaaatcacgaccaacctcgttcaattaccagattt
ggtgacgattctcccaaaaaccgtgttatttctggtaagttgttgtctgtgttgttggtg
tcactgagcggtactctatatgtgtaccaaggacaggaactgggtgaaatcaatttcaag
aactggcctatcgaaaaatacgaggatgtcgaagttagaaataactatgatgcgatcaag
gaagagcatggagaaaactcgaaggagatgaagaggtttttggaagcaattgcccttatt
tccagagaccatgctagaacacctatgcaatggtctcgtgaggagccaaatgctggtttt
tctggtcctaatgctaaaccatggttttacttgaacgagtctttcagggaaggaattaac
gctgaagacgaatccaaggaccccaactcggttttgaacttctggaaggaggccttgaga
tttagaaaggcacacaaggatattactgtgtatggatatgattttgagtttattgatttg
gacaataagaaactgttcagcttcacaaagaaatacgacaacaaaacattgtttgctgct
ttgaacttcagctctgattcgatcgacttcacgattccaaacaatagctcatcgtttaag
ttggaattcggaaactacccaagaagtgaagttgatgcgtcttccagaacattgaagcca
tgggagggcagaatttacatatctgaatga

DBGET integrated database retrieval system