KEGG   Saccharomyces cerevisiae (budding yeast): YIR031CHelp
Entry
YIR031C           CDS       T00005                                 

Gene name
DAL7, MLS2, MSL2
Definition
(RefSeq) malate synthase DAL7
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00620  Pyruvate metabolism
sce00630  Glyoxylate and dicarboxylate metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01200  Carbon metabolism
Module
sce_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    YIR031C (DAL7)
   00630 Glyoxylate and dicarboxylate metabolism
    YIR031C (DAL7)
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     YIR031C (DAL7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-GeneID: 854849
NCBI-ProteinID: NP_012297
SGD: S000001470
UniProt: P21826
Position
IX:complement(413015..414679)
Genome map
AA seq 554 aa AA seqDB search
MVKISLDNTALYADIDTTPQFEPSKTTVADILTKDALEFIVLLHRTFNSTRKQLLANRSN
LQSKLDSGEYRFDFLPETEQIRNDPTWQGAIPAPGLINRSSEITGPPLRNMLVNALNAEV
TTYMTDFEDSSSPTWENMIYGQVNLYDAIRNQIDFKTPRKEYRLKDDISRLPTLIVRPRG
WHMVEKHLYIDDEPISASIFDFGLYFYHNAKELVKIGKGPYFYLPKMEHHMEVKLWNDIF
CVAQDFIGMPRGTIRATVLIETLPAAFQMEEIIYQIREHSSGLNCGRWDYIFSTIKKLRN
LPEHVLPNRDLVTMTSPFMDAYVKRLINTCHRRGVHAMGGMAAQIPIKDDPKANEAAMNK
VRNDKIREMKNGHDGSWVAHPALAPICNEVFSNMGTANQIYFVPDVHVTSSDLLNTKIQD
AQVTTEGIRVNLDIGLQYMEAWLRGSGCVPINHLMEDAATAEVSRCQLYQWVKHGVVLSD
TGDKVTPELTAKILNEETAKLASASPLGEKNKFALAAKYFLPEVTGKIFSDFLTTLLYDE
IIKPSAKPVDLSKL
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagataagcttggacaacactgctctatacgcagacatcgacacgactcctcaa
tttgaaccttccaaaactactgtagctgatattttaacaaaagatgccttagagttcatt
gttttgctgcatagaactttcaattcaacacggaaacagcttttagccaacagaagcaat
ttacaatcaaagttagactctggtgaataccgatttgatttcttgccggaaaccgaacaa
atcaggaacgatcctacatggcaaggtgctatcccagcccctggtttgatcaacagatcc
agcgagattactgggccaccattgagaaatatgttagtcaacgctttgaatgctgaagta
acgacatatatgactgatttcgaggactcttcatctccaacttgggagaacatgatttac
ggacaagttaatctttatgatgccattagaaatcaaatcgatttcaagacaccaagaaag
gagtacaggttgaaggatgacatttcaagactgcccactttaattgtcagacctcgtggc
tggcacatggtggagaagcacctttacatagatgatgaaccgattagtgcttccatcttc
gattttggtttatatttttaccataacgctaaagagttagttaaaattggtaaaggacct
tatttttacttaccaaagatggagcaccatatggaggtaaaactatggaatgacatattc
tgtgttgcacaagattttattggaatgccccgcggtaccattagggccactgttctgatt
gaaactttgccagcggccttccaaatggaggagattatctatcaaataagagaacattca
agcggtttgaactgtggtcgttgggactacatattttcgaccattaaaaaactgagaaac
ttgcctgaacacgttttgccaaatagggatctagtgactatgacttcaccttttatggat
gcttatgtgaaaagattgatcaatacatgtcaccgtagaggggtccatgcgatgggtggt
atggctgcccaaatccccataaaagatgatccaaaggctaatgaagctgcaatgaacaaa
gttcgtaatgacaaaattagagaaatgaagaatgggcatgatgggtcatgggtagcacac
ccagcattggcaccgatttgtaatgaagttttcagtaacatgggtacagcaaatcaaata
tattttgtcccggatgtacatgttacatcatctgatttattgaatacgaagattcaagat
gctcaagtcactactgagggaatcagagtaaacttggatattggcctacaatatatggag
gcttggttaaggggatctggttgtgtcccaattaatcatttgatggaagatgccgctact
gcggaagtatcacgttgtcaattgtaccagtgggttaaacatggtgttgtcttaagtgat
accggtgacaaagtaactccagaattgaccgctaagatattaaatgaagagactgcaaaa
ttggcttcagcaagtccgctgggtgaaaagaacaagtttgccttggcagccaagtatttt
ttgcctgaagtcactggtaaaatctttagcgacttcttgaccactttattgtatgatgaa
attattaagccaagtgccaaaccagttgacttaagtaaattatag

DBGET integrated database retrieval system