KEGG   Saccharomyces cerevisiae (budding yeast): YIR031CHelp
Entry
YIR031C           CDS       T00005                                 

Gene name
DAL7, MLS2, MSL2
Definition
malate synthase DAL7 (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:sce01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sce00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:sce00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IX:complement(413015..414679)
Genome map
AA seq 554 aa AA seqDB search
MVKISLDNTALYADIDTTPQFEPSKTTVADILTKDALEFIVLLHRTFNSTRKQLLANRSN
LQSKLDSGEYRFDFLPETEQIRNDPTWQGAIPAPGLINRSSEITGPPLRNMLVNALNAEV
TTYMTDFEDSSSPTWENMIYGQVNLYDAIRNQIDFKTPRKEYRLKDDISRLPTLIVRPRG
WHMVEKHLYIDDEPISASIFDFGLYFYHNAKELVKIGKGPYFYLPKMEHHMEVKLWNDIF
CVAQDFIGMPRGTIRATVLIETLPAAFQMEEIIYQIREHSSGLNCGRWDYIFSTIKKLRN
LPEHVLPNRDLVTMTSPFMDAYVKRLINTCHRRGVHAMGGMAAQIPIKDDPKANEAAMNK
VRNDKIREMKNGHDGSWVAHPALAPICNEVFSNMGTANQIYFVPDVHVTSSDLLNTKIQD
AQVTTEGIRVNLDIGLQYMEAWLRGSGCVPINHLMEDAATAEVSRCQLYQWVKHGVVLSD
TGDKVTPELTAKILNEETAKLASASPLGEKNKFALAAKYFLPEVTGKIFSDFLTTLLYDE
IIKPSAKPVDLSKL
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagataagcttggacaacactgctctatacgcagacatcgacacgactcctcaa
tttgaaccttccaaaactactgtagctgatattttaacaaaagatgccttagagttcatt
gttttgctgcatagaactttcaattcaacacggaaacagcttttagccaacagaagcaat
ttacaatcaaagttagactctggtgaataccgatttgatttcttgccggaaaccgaacaa
atcaggaacgatcctacatggcaaggtgctatcccagcccctggtttgatcaacagatcc
agcgagattactgggccaccattgagaaatatgttagtcaacgctttgaatgctgaagta
acgacatatatgactgatttcgaggactcttcatctccaacttgggagaacatgatttac
ggacaagttaatctttatgatgccattagaaatcaaatcgatttcaagacaccaagaaag
gagtacaggttgaaggatgacatttcaagactgcccactttaattgtcagacctcgtggc
tggcacatggtggagaagcacctttacatagatgatgaaccgattagtgcttccatcttc
gattttggtttatatttttaccataacgctaaagagttagttaaaattggtaaaggacct
tatttttacttaccaaagatggagcaccatatggaggtaaaactatggaatgacatattc
tgtgttgcacaagattttattggaatgccccgcggtaccattagggccactgttctgatt
gaaactttgccagcggccttccaaatggaggagattatctatcaaataagagaacattca
agcggtttgaactgtggtcgttgggactacatattttcgaccattaaaaaactgagaaac
ttgcctgaacacgttttgccaaatagggatctagtgactatgacttcaccttttatggat
gcttatgtgaaaagattgatcaatacatgtcaccgtagaggggtccatgcgatgggtggt
atggctgcccaaatccccataaaagatgatccaaaggctaatgaagctgcaatgaacaaa
gttcgtaatgacaaaattagagaaatgaagaatgggcatgatgggtcatgggtagcacac
ccagcattggcaccgatttgtaatgaagttttcagtaacatgggtacagcaaatcaaata
tattttgtcccggatgtacatgttacatcatctgatttattgaatacgaagattcaagat
gctcaagtcactactgagggaatcagagtaaacttggatattggcctacaatatatggag
gcttggttaaggggatctggttgtgtcccaattaatcatttgatggaagatgccgctact
gcggaagtatcacgttgtcaattgtaccagtgggttaaacatggtgttgtcttaagtgat
accggtgacaaagtaactccagaattgaccgctaagatattaaatgaagagactgcaaaa
ttggcttcagcaagtccgctgggtgaaaagaacaagtttgccttggcagccaagtatttt
ttgcctgaagtcactggtaaaatctttagcgacttcttgaccactttattgtatgatgaa
attattaagccaagtgccaaaccagttgacttaagtaaattatag

DBGET integrated database retrieval system