KEGG   Saccharomyces cerevisiae (budding yeast): YIR037WHelp
Entry
YIR037W           CDS       T00005                                 

Gene name
HYR1, GPX3, ORP1
Definition
peroxiredoxin HYR1 (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    YIR037W (HYR1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    YIR037W (HYR1)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     YIR037W (HYR1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
IX:423128..423619
Genome map
AA seq 163 aa AA seqDB search
MSEFYKLAPVDKKGQPFPFDQLKGKVVLIVNVASKCGFTPQYKELEALYKRYKDEGFTII
GFPCNQFGHQEPGSDEEIAQFCQLNYGVTFPIMKKIDVNGGNEDPVYKFLKSQKSGMLGL
RGIKWNFEKFLVDKKGKVYERYSSLTKPSSLSETIEELLKEVE
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaattctataagctagcacctgttgacaagaaaggccaaccattccccttcgac
caattaaagggaaaagtggtgcttatcgttaatgttgcctccaaatgtggattcactcct
caatacaaagaactagaggccttgtacaaacgttataaggacgaaggatttaccatcatc
gggttcccatgcaaccagtttggccaccaagaacctggctctgatgaagaaattgcccag
ttctgccaactgaactatggcgtgactttccccattatgaaaaaaattgacgttaatggt
ggcaatgaggaccctgtttacaagtttttgaagagccaaaaatccggtatgttgggcttg
agaggtatcaaatggaattttgaaaaattcttagtcgataaaaagggtaaagtgtacgaa
agatactcttcactaaccaaaccttcttcgttgtccgaaaccatcgaagaacttttgaaa
gaggtggaatag

DBGET integrated database retrieval system