KEGG   Saccharomyces cerevisiae (budding yeast): YJL013CHelp
Entry
YJL013C           CDS       T00005                                 

Gene name
MAD3
Definition
Mad3p
Orthology
K06680  
spindle assembly checkpoint component MAD3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YJL013C (MAD3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
X:complement(409493..411040)
Genome map
AA seq 515 aa AA seqDB search
MKAYAKKRISYMPSSPSQNVINFEEIETQKENILPLKEGRSAAALSKAIHQPLVEINQVK
SSFEQRLIDELPALSDPITLYLEYIKWLNNAYPQGGNSKQSGMLTLLERCLSHLKDLERY
RNDVRFLKIWFWYIELFTRNSFMESRDIFMYMLRNGIGSELASFYEEFTNLLIQKEKFQY
AVKILQLGIKNKARPNKVLEDRLNHLLRELGENNIQLGNEISMDSLESTVLGKTRSEFVN
RLELANQNGTSSDVNLTKNNVFVDGEESDVELFETPNRGVYRDGWENFDLKAERNKENNL
RISLLEANTNLGELKQHEMLSQKKRPYDEKLPIFRDSIGRSDPVYQMINTKDQKPEKIDC
NFKLIYCEDEESKGGRLEFSLEEVLAISRNVYKRVRTNRKHPREANLGQEESANQKEAEA
QSKRPKISRKALVSKSLTPSNQGRMFSGEEYINCPMTPKGRSTETSDIISAVKPRQLTPI
LEMRESNSFSQSKNSEIISDDDKSSSSFISYPPQR
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgtacgcaaagaaacgtatctcttacatgccatcgtcaccatcacaaaatgtt
attaactttgaagaaatcgaaactcaaaaagaaaacattcttcccctgaaggaaggcaga
tcagcagcggcactctcgaaagcgatacatcaaccactggtggaaataaaccaagttaaa
tcaagcttcgaacaaagactgatagatgagctccctgcattaagcgacccaattactttg
tatcttgaatacataaagtggctgaacaacgcctatccacaaggcggtaattccaaacaa
tctggaatgctcacccttttggagcgatgtttatctcacttaaaggatttggagagatat
cgcaatgatgttaggtttcttaaaatatggttttggtacatagaactttttaccagaaat
tcattcatggaaagcagagacattttcatgtatatgttaagaaatggaattggttccgag
ttagcgtcattttatgaagaatttacgaatctattaattcagaaagaaaaatttcaatat
gccgtgaaaattctacagctaggaatcaaaaataaggctaggcctaataaggttttagaa
gaccggttaaaccatctcctgagagaactgggggagaacaatattcagctaggaaatgaa
atatcgatggactcattagagtctacagtacttgggaaaaccagatctgaatttgtcaat
agactagagcttgcaaatcaaaatggcacatcaagtgacgtcaatttaacaaaaaacaac
gtatttgtagatggagaagagtctgatgtagaactattcgaaactccgaatagaggtgtt
tatagagatggctgggaaaattttgacttaaaggcagaaaggaacaaagaaaacaacctt
cgaatatcattgctagaagcaaataccaatttgggtgagcttaaacaacatgagatgtta
tcgcaaaaaaagagaccatatgatgaaaaactaccgatctttagagattctataggtaga
agtgaccctgtttatcaaatgattaatacaaaggaccagaaaccagaaaaaattgactgt
aattttaaactgatttattgtgaagatgaggaatctaaaggtggtagactagaattttcg
ctagaagaagtcttggcaatttctagaaacgtttataaaagggttaggacaaataggaaa
catccaagagaagcaaatttagggcaagaagaaagcgcaaatcaaaaagaagctgaagca
caatcgaaaagaccaaaaataagtagaaaagccttagtctccaagtcgttgaccccctca
aaccagggaagaatgttttctggcgaagagtacataaactgccctatgacgccaaaggga
cgaagcactgagacgtctgatatcatctcagctgtcaagccgcggcagttaaccccaatt
ttagaaatgagagaatcaaattctttttctcaaagcaaaaattctgagatcatttcagat
gatgacaagtcgagttcgtctttcatatcgtacccaccacagcgttga

DBGET integrated database retrieval system