KEGG   Saccharomyces cerevisiae (budding yeast): YJL030WHelp
Entry
YJL030W           CDS       T00005                                 

Gene name
MAD2
Definition
Mad2p
Orthology
K02537  
mitotic spindle assembly checkpoint protein MAD2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:sce04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:sce04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
X:387657..388247
Genome map
AA seq 196 aa AA seqDB search
MSQSISLKGSTRTVTEFFEYSINSILYQRGVYPAEDFVTVKKYDLTLLKTHDDELKDYIR
KILLQVHRWLLGGKCNQLVLCIVDKDEGEVVERWSFNVQHISGNSNGQDDVVDLNTTQSQ
IRALIRQITSSVTFLPELTKEGGYTFTVLAYTDADAKVPLEWADSNSKEIPDGEVVQFKT
FSTNDHKVGAQVSYKY
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaatcaatatcactaaagggttcaacaaggacagttacagaatttttcgagtac
agcattaattccattttgtaccaaagaggcgtatacccagcagaagatttcgtaacggtg
aaaaagtacgatcttacgttactaaagacacatgatgatgaactgaaagattacattcgg
aaaattcttctacaagttcacaggtggcttcttggtggaaaatgcaatcaattagtatta
tgtattgtagacaaggatgagggagaggtggtggaaagatggtccttcaatgtgcaacac
atttctggcaatagcaacgggcaggatgatgttgtagatttaaatacaacacaatcacaa
atcagagctttaatcaggcaaatcacctcaagcgttacctttctgcccgaactaacaaaa
gaaggtgggtacacattcacagtacttgcatatacagacgcggatgctaaagttccgtta
gaatgggccgactccaatagtaaagagatacctgatggtgaagtagttcaattcaaaaca
ttctctaccaacgatcataaagttggtgcgcaggtcagctataaatattaa

DBGET integrated database retrieval system