KEGG   Saccharomyces cerevisiae (budding yeast): YJL030WHelp
Entry
YJL030W           CDS       T00005                                 

Gene name
MAD2
Definition
spindle checkpoint protein MAD2
Orthology
K02537  
mitotic spindle assembly checkpoint protein MAD2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YJL030W (MAD2)
   04113 Meiosis - yeast
    YJL030W (MAD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
X:387657..388247
Genome map
AA seq 196 aa AA seqDB search
MSQSISLKGSTRTVTEFFEYSINSILYQRGVYPAEDFVTVKKYDLTLLKTHDDELKDYIR
KILLQVHRWLLGGKCNQLVLCIVDKDEGEVVERWSFNVQHISGNSNGQDDVVDLNTTQSQ
IRALIRQITSSVTFLPELTKEGGYTFTVLAYTDADAKVPLEWADSNSKEIPDGEVVQFKT
FSTNDHKVGAQVSYKY
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaatcaatatcactaaagggttcaacaaggacagttacagaatttttcgagtac
agcattaattccattttgtaccaaagaggcgtatacccagcagaagatttcgtaacggtg
aaaaagtacgatcttacgttactaaagacacatgatgatgaactgaaagattacattcgg
aaaattcttctacaagttcacaggtggcttcttggtggaaaatgcaatcaattagtatta
tgtattgtagacaaggatgagggagaggtggtggaaagatggtccttcaatgtgcaacac
atttctggcaatagcaacgggcaggatgatgttgtagatttaaatacaacacaatcacaa
atcagagctttaatcaggcaaatcacctcaagcgttacctttctgcccgaactaacaaaa
gaaggtgggtacacattcacagtacttgcatatacagacgcggatgctaaagttccgtta
gaatgggccgactccaatagtaaagagatacctgatggtgaagtagttcaattcaaaaca
ttctctaccaacgatcataaagttggtgcgcaggtcagctataaatattaa

DBGET integrated database retrieval system