KEGG   Saccharomyces cerevisiae (budding yeast): YJL030WHelp
Entry
YJL030W           CDS       T00005                                 

Gene name
MAD2
Definition
(RefSeq) spindle checkpoint protein MAD2
  KO
K02537  
mitotic spindle assembly checkpoint protein MAD2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YJL030W (MAD2)
   04113 Meiosis - yeast
    YJL030W (MAD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
X:387657..388247
Genome map
AA seq 196 aa AA seqDB search
MSQSISLKGSTRTVTEFFEYSINSILYQRGVYPAEDFVTVKKYDLTLLKTHDDELKDYIR
KILLQVHRWLLGGKCNQLVLCIVDKDEGEVVERWSFNVQHISGNSNGQDDVVDLNTTQSQ
IRALIRQITSSVTFLPELTKEGGYTFTVLAYTDADAKVPLEWADSNSKEIPDGEVVQFKT
FSTNDHKVGAQVSYKY
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaatcaatatcactaaagggttcaacaaggacagttacagaatttttcgagtac
agcattaattccattttgtaccaaagaggcgtatacccagcagaagatttcgtaacggtg
aaaaagtacgatcttacgttactaaagacacatgatgatgaactgaaagattacattcgg
aaaattcttctacaagttcacaggtggcttcttggtggaaaatgcaatcaattagtatta
tgtattgtagacaaggatgagggagaggtggtggaaagatggtccttcaatgtgcaacac
atttctggcaatagcaacgggcaggatgatgttgtagatttaaatacaacacaatcacaa
atcagagctttaatcaggcaaatcacctcaagcgttacctttctgcccgaactaacaaaa
gaaggtgggtacacattcacagtacttgcatatacagacgcggatgctaaagttccgtta
gaatgggccgactccaatagtaaagagatacctgatggtgaagtagttcaattcaaaaca
ttctctaccaacgatcataaagttggtgcgcaggtcagctataaatattaa

DBGET integrated database retrieval system