KEGG   Saccharomyces cerevisiae (budding yeast): YJL039CHelp
Entry
YJL039C           CDS       T00005                                 

Gene name
NUP192
Definition
Nup192p
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    YJL039C (NUP192)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     YJL039C (NUP192)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
X:complement(368748..373799)
Genome map
AA seq 1683 aa AA seqDB search
MKWSAIPFQTLYRSIESGEFDFDLFKEVLPDLQNLNLNTDKLKNNASRSQLEKGEIELSD
GSTFKVNQEFIFEAISLSDELNLDEIVACELILSGDTTANNGKVQYFLRRQYILQIVSFI
VNCFHEDTELYQELIKNGALVSNILSAFKFIHTQLSEIKQQINKAQILENYNALFQQNIK
FRRDFLLREYDILSQILYGLVDKGAIMKNKDFILSLLHHVSELDSNDFFIIYYTPAFFHL
FASLRVLPDADVKLLHSQFMKDLKDDSIYTKPVKVALIFIFFAYFIGWCKEDPKRRADTM
DFKTDVDEPMTSAVELGAIEQILIFAADTSIVEQDKSMELFYDIRSLLERHIPRLIPKQL
LDDEKIFSQTTNSTYNPASATDNMSGRGLWNPSYPGMMSTTGTARLNSMPNNVNEYSYTT
IVLSDQTQEFFLSSFDDVLQTIITDCAFLLTKIKDAEEDSLLSGEDLTLDDISLKADLER
FFLSIYFFYASRPEYSCTFWSDKESNAYGFIEWCSRCNDNLMRSCFYLMVSSLSFGPENA
LNVYHYFGENSSISWKNIAQCLSDYTKKISNFNSSLHKRQQFSESTHNDIDSTAVALEEG
LNEEAVIFLSSLLTLVGSVTYQVDEDVKSSLSKVFSDVLFEFTKINTPLVGAAFKVISNL
VPKLESSRTKFWSFLDSLIFKDSSLNYSSESYRNAFTNVLTKYSDVLGFLQLFHNLISIH
SRENNSEYMVFGKLAFPTRLGQGYRKVGIWPYFDYIFNDILAHVDQIVDIRNKRAVQLPI
LKIIYTGLCSFDYSVILNSIPAAANLDALVDCENFFNYVQECPAIPIFNYIFTEKIYKSI
FNVVDVGVDQLSIELEGGKNQAELLQLAVKIINKVLDYQETYVEELFPIVKKHGKTDYFL
PKNYSLHGLRSFYDAIFFNIPLVAHLGLYVGVDDQILATNSLRILAKLSERSNGSVASLS
KRNKLLTIFDSVDESARIKDAFITQLESSITDAGVLALKLELLDFLTSNLSNYSRTMTIS
HLLLGFQVSNVISLGPNLATFISSGTSLLDSLISVLEASLNSITKDNIDYAPMRLATAAL
EIILKLCRNPLTSGLLYSYLIKENFFERIMILDPQVTRFTTWNGSPFDNSTEEKCKNFIE
SESVGAFLSFLAYRNYWTQYLGLFIHKISFSGTKSEVLTYVNYLISNTMYSVRLFSFLDP
LNYGNICEPKETLSIFTNVPLNLEQVTLNKYCSGNIYDFHKMENLMRLIKRVRAESLHSN
SFSLTVSKEQFLKDADVECIKAKSHFTNIISRNKALELNLSVLHSWVQLVQIIVTDGKLE
PSTRSNFILEVFGTIIPKISDYIEFNITFSEELVSLAVFLFDIYNRDRKLITDKGTVDGR
LYQLFKTCIQGINSPLSSVALRSDFYILANHYLSRVLSDQVGSEKVLQDLRLGSKKLVEI
IWNDVVYGEGTSRVTGILLLDSLIQLANRSKENFILDSLMKTTRLLLIIRSLKNTDALLN
STTEHINIDDLLYELTAFKATVFFLIRVAETRGGASALIENNLFRIIAELSFLKVDPDLG
LDLMFDEVYVQNSKFLKVNVTLDNPLLVDKDANGVSLFELIVPIFQLISAVLVSMGSSNK
AVVQTVKGLLNTYKRLVIGIFKRDLLREKEDKKNSSDPNNQSLNEMVKLIVMLCTLTGYQ
NND
NT seq 5052 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggtctgcaattcctttccaaacattgtatcgctctattgagagtggtgagttc
gattttgatctgttcaaagaggtacttcctgacttacaaaatttgaacttaaacacagac
aaactaaaaaacaatgctagccgatcacaattagaaaaaggtgaaattgaactatccgat
ggctctacttttaaggtcaatcaggagtttattttcgaagctatttctttgtccgatgaa
ttaaacttggatgaaattgttgcatgtgaacttatactttctggtgataccaccgctaat
aatggcaaagtacaatactttttgagaaggcaatatatcctgcaaattgtttcttttata
gtcaactgtttccacgaagatactgagttataccaagagcttataaagaatggagcttta
gtttctaatatcctctcagcctttaagttcattcatactcaattatctgagattaaacaa
caaatcaataaggctcagatactagaaaactataatgctttattccaacaaaatatcaag
tttaggagagacttcttactgagagaatatgatattctgagtcaaattttatatggttta
gtggataaaggagccatcatgaaaaataaggattttatactgtccttacttcatcatgtg
tcagaattggattccaatgatttttttataatatattatactcctgcatttttccacctt
ttcgcatctttaagagttttgcccgatgcagatgtcaaattattacattctcagtttatg
aaagacttaaaggacgactccatatataccaaaccggtcaaagtagctcttattttcatt
ttttttgcttacttcattgggtggtgtaaagaagaccctaaaagaagggctgacacgatg
gatttcaaaactgatgttgatgagccaatgacttctgccgtcgaactaggcgctattgaa
caaattttaatatttgccgcagatacatctatcgtggaacaagacaagagtatggaactt
ttctacgatataaggtccctgttagaaaggcatattccaaggctaattcctaaacagtta
cttgatgatgaaaaaattttcagtcaaacgacgaattctacctacaacccagcatccgca
actgataatatgagcggacgcggcttatggaatccgtcttatcctgggatgatgtcaacc
acgggtaccgctcgactaaatagtatgcccaataacgtcaacgaatattcttacactact
atagttttatccgatcagacccaagaatttttcctctcatcctttgatgatgtgcttcaa
actattattacagattgtgcctttttgcttacaaagattaaggatgctgaggaagactct
ttgttgtccggtgaagacttaactttggatgacatctcactaaaggctgacttagaaaga
ttttttctgtcaatatattttttctatgcatcaaggcccgaatattcatgtactttctgg
tctgataaggaatcaaacgcttatggttttattgagtggtgttcgagatgcaacgacaac
ttgatgaggtcttgtttctatttgatggtttctagcttgtcctttggtcctgaaaatgcc
ctgaatgtctatcactattttggcgaaaacagctcgatttcatggaaaaacattgcacag
tgtctcagtgactacactaagaaaataagcaattttaactcgagcctccataagaggcag
cagtttagtgagtcaactcataacgatatcgattcgactgcggtagccttagaagaaggc
ttaaatgaagaagctgtaatatttctgtcttctttattaactttagttggatcagttaca
taccaggttgacgaggatgtaaaaagctcgctatcgaaagttttctcagatgtcctattc
gaattcaccaagataaatacacctctcgtaggcgctgctttcaaggttataagtaacttg
gttccaaaacttgaatcttctagaacaaaattttggtcttttctagactctctaattttc
aaggattcatcgctgaattattcatccgaatcttatagaaatgcttttacaaacgtgtta
acaaaatactctgacgttttggggtttttacaactcttccataatctgatttctattcat
tctcgtgaaaataatagtgaatacatggtttttggcaaattggcatttccaacaagatta
ggtcagggatataggaaggtaggtatatggccatattttgactacattttcaacgacatt
ttagcgcacgtggatcaaattgttgatatcagaaataaaagagccgtccagcttcctatt
ttgaaaattatctatacgggcttatgctcttttgattacagtgtaattttaaattctatt
cctgcagctgcgaatttggatgctttggtggattgcgaaaatttcttcaattacgttcaa
gaatgcccagctatccccatattcaactatattttcacggaaaagatttacaaaagtata
tttaatgtagttgatgttggtgttgatcaattgtccatagagttagaaggtggcaaaaat
caggctgaattgttgcagttagctgtgaaaattatcaataaagtattggattatcaggag
acatacgtggaagaattatttccaattgttaagaagcatggcaagacggattatttcttg
ccaaagaattattctcttcacggattacgttcattttacgatgcaatttttttcaatatt
ccacttgttgcacacttgggtttatacgtcggggtcgatgatcaaattttagccacaaat
tcactgcgtattttggcgaaactttcagaacgctctaatggctccgttgcgtctttgtct
aagagaaataagttgttaacaatattcgattccgtagatgaatcagccagaataaaggat
gcatttattacacaattggaaagctcaataaccgacgctggtgtccttgctttgaagtta
gaactattagatttcttaacatcaaatctttctaattatagtcgaacgatgactatttct
catctgttattaggtttccaggtctcaaacgttatatccctgggacctaacctagcaaca
tttatatcttccggaacctcattacttgattccctcataagcgtgttggaagcttcattg
aacagcattactaaggacaatatcgattatgcacctatgagattggctacagcagcactg
gaaattattctcaaactatgtcgtaatccgttaacatctggtctactatattcataccta
atcaaagaaaacttttttgagagaataatgatcctcgatccacaagtgacaaggttcacg
acatggaacggctctccttttgacaattctacagaggaaaaatgtaagaacttcatcgag
agcgaatccgttggtgcatttctgtcattcttagcctacaggaattattggacacaatat
ttgggtctgttcattcataaaatttcattttcgggcacgaaatcagaggttttaacatat
gtgaattacttgatatcaaatacaatgtattcggtaaggttgttttctttcttggatcca
ttaaactatggcaatatctgcgaaccaaaagagacgttatcaattttcaccaatgttcct
ttaaatttggaacaagtcactcttaacaagtattgctccggcaatatctatgactttcac
aaaatggaaaaccttatgcgcctgattaaaagagtccgtgctgaaagcttacattctaat
tccttcagtctcactgtgtcaaaagaacaatttttgaaggatgcagatgtcgagtgtata
aaagcaaaaagccatttcacgaatattatatcaagaaacaaagcattggagttgaaccta
tctgtgctgcactcttgggtacagttggtgcaaatcattgttactgatggaaaattggaa
ccatcaacaagatcaaactttattctggaggtttttggtacaattattccgaagattagt
gattatattgagtttaatataactttttcagaagaattggtttctctcgccgttttccta
tttgatatatataaccgcgatcgtaagttgattaccgacaaaggcacggtagacggcagg
ctatatcagttgttcaagacatgtattcagggtataaactccccactctcctctgtggca
ttaaggtccgatttctatatattagcaaaccattatttgagtagagttctaagcgaccaa
gtagggtccgaaaaggttctgcaggatttgagactaggaagtaaaaaattggtagagatc
atatggaacgatgttgtttatggcgagggaactagtagggttacaggtatattactattg
gattcacttattcaactggctaatagaagtaaagagaattttatattggattcactgatg
aaaactacaagactgctcttaataatacgttcgctgaaaaatacagatgctttgttaaat
tctactacagagcacataaacattgatgatttgttatatgaattgacagcttttaaagcc
actgtattctttttaatacgtgttgccgaaactagaggtggagctagcgctttaattgaa
aataatctattccgaataatcgcggaattgtcatttttaaaagttgatcctgatttgggt
ctagaccttatgtttgacgaagtctacgttcagaattccaaattcttaaaggttaacgtc
accttggataatccgctactagttgacaaagatgctaatggtgtttccttgtttgagtta
atcgttcctatattccaattgatatcagctgttttagtgagcatggggagctcaaacaaa
gctgttgttcaaacggtaaagggtttactgaatacgtataagaggctagtgatcggaata
ttcaaaagagatcttttgagggaaaaagaagataagaaaaattcgtcggatcctaataac
caaagtttaaacgaaatggtgaagctaattgtgatgttatgcacattaacaggatatcaa
aataacgattaa

DBGET integrated database retrieval system