KEGG   Saccharomyces cerevisiae (budding yeast): YJL039CHelp
Entry
YJL039C           CDS       T00005                                 

Gene name
NUP192
Definition
(RefSeq) Nup192p
  KO
K14310  
nuclear pore complex protein Nup205
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    YJL039C (NUP192)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     YJL039C (NUP192)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
X:complement(368748..373799)
Genome map
AA seq 1683 aa AA seqDB search
MKWSAIPFQTLYRSIESGEFDFDLFKEVLPDLQNLNLNTDKLKNNASRSQLEKGEIELSD
GSTFKVNQEFIFEAISLSDELNLDEIVACELILSGDTTANNGKVQYFLRRQYILQIVSFI
VNCFHEDTELYQELIKNGALVSNILSAFKFIHTQLSEIKQQINKAQILENYNALFQQNIK
FRRDFLLREYDILSQILYGLVDKGAIMKNKDFILSLLHHVSELDSNDFFIIYYTPAFFHL
FASLRVLPDADVKLLHSQFMKDLKDDSIYTKPVKVALIFIFFAYFIGWCKEDPKRRADTM
DFKTDVDEPMTSAVELGAIEQILIFAADTSIVEQDKSMELFYDIRSLLERHIPRLIPKQL
LDDEKIFSQTTNSTYNPASATDNMSGRGLWNPSYPGMMSTTGTARLNSMPNNVNEYSYTT
IVLSDQTQEFFLSSFDDVLQTIITDCAFLLTKIKDAEEDSLLSGEDLTLDDISLKADLER
FFLSIYFFYASRPEYSCTFWSDKESNAYGFIEWCSRCNDNLMRSCFYLMVSSLSFGPENA
LNVYHYFGENSSISWKNIAQCLSDYTKKISNFNSSLHKRQQFSESTHNDIDSTAVALEEG
LNEEAVIFLSSLLTLVGSVTYQVDEDVKSSLSKVFSDVLFEFTKINTPLVGAAFKVISNL
VPKLESSRTKFWSFLDSLIFKDSSLNYSSESYRNAFTNVLTKYSDVLGFLQLFHNLISIH
SRENNSEYMVFGKLAFPTRLGQGYRKVGIWPYFDYIFNDILAHVDQIVDIRNKRAVQLPI
LKIIYTGLCSFDYSVILNSIPAAANLDALVDCENFFNYVQECPAIPIFNYIFTEKIYKSI
FNVVDVGVDQLSIELEGGKNQAELLQLAVKIINKVLDYQETYVEELFPIVKKHGKTDYFL
PKNYSLHGLRSFYDAIFFNIPLVAHLGLYVGVDDQILATNSLRILAKLSERSNGSVASLS
KRNKLLTIFDSVDESARIKDAFITQLESSITDAGVLALKLELLDFLTSNLSNYSRTMTIS
HLLLGFQVSNVISLGPNLATFISSGTSLLDSLISVLEASLNSITKDNIDYAPMRLATAAL
EIILKLCRNPLTSGLLYSYLIKENFFERIMILDPQVTRFTTWNGSPFDNSTEEKCKNFIE
SESVGAFLSFLAYRNYWTQYLGLFIHKISFSGTKSEVLTYVNYLISNTMYSVRLFSFLDP
LNYGNICEPKETLSIFTNVPLNLEQVTLNKYCSGNIYDFHKMENLMRLIKRVRAESLHSN
SFSLTVSKEQFLKDADVECIKAKSHFTNIISRNKALELNLSVLHSWVQLVQIIVTDGKLE
PSTRSNFILEVFGTIIPKISDYIEFNITFSEELVSLAVFLFDIYNRDRKLITDKGTVDGR
LYQLFKTCIQGINSPLSSVALRSDFYILANHYLSRVLSDQVGSEKVLQDLRLGSKKLVEI
IWNDVVYGEGTSRVTGILLLDSLIQLANRSKENFILDSLMKTTRLLLIIRSLKNTDALLN
STTEHINIDDLLYELTAFKATVFFLIRVAETRGGASALIENNLFRIIAELSFLKVDPDLG
LDLMFDEVYVQNSKFLKVNVTLDNPLLVDKDANGVSLFELIVPIFQLISAVLVSMGSSNK
AVVQTVKGLLNTYKRLVIGIFKRDLLREKEDKKNSSDPNNQSLNEMVKLIVMLCTLTGYQ
NND
NT seq 5052 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggtctgcaattcctttccaaacattgtatcgctctattgagagtggtgagttc
gattttgatctgttcaaagaggtacttcctgacttacaaaatttgaacttaaacacagac
aaactaaaaaacaatgctagccgatcacaattagaaaaaggtgaaattgaactatccgat
ggctctacttttaaggtcaatcaggagtttattttcgaagctatttctttgtccgatgaa
ttaaacttggatgaaattgttgcatgtgaacttatactttctggtgataccaccgctaat
aatggcaaagtacaatactttttgagaaggcaatatatcctgcaaattgtttcttttata
gtcaactgtttccacgaagatactgagttataccaagagcttataaagaatggagcttta
gtttctaatatcctctcagcctttaagttcattcatactcaattatctgagattaaacaa
caaatcaataaggctcagatactagaaaactataatgctttattccaacaaaatatcaag
tttaggagagacttcttactgagagaatatgatattctgagtcaaattttatatggttta
gtggataaaggagccatcatgaaaaataaggattttatactgtccttacttcatcatgtg
tcagaattggattccaatgatttttttataatatattatactcctgcatttttccacctt
ttcgcatctttaagagttttgcccgatgcagatgtcaaattattacattctcagtttatg
aaagacttaaaggacgactccatatataccaaaccggtcaaagtagctcttattttcatt
ttttttgcttacttcattgggtggtgtaaagaagaccctaaaagaagggctgacacgatg
gatttcaaaactgatgttgatgagccaatgacttctgccgtcgaactaggcgctattgaa
caaattttaatatttgccgcagatacatctatcgtggaacaagacaagagtatggaactt
ttctacgatataaggtccctgttagaaaggcatattccaaggctaattcctaaacagtta
cttgatgatgaaaaaattttcagtcaaacgacgaattctacctacaacccagcatccgca
actgataatatgagcggacgcggcttatggaatccgtcttatcctgggatgatgtcaacc
acgggtaccgctcgactaaatagtatgcccaataacgtcaacgaatattcttacactact
atagttttatccgatcagacccaagaatttttcctctcatcctttgatgatgtgcttcaa
actattattacagattgtgcctttttgcttacaaagattaaggatgctgaggaagactct
ttgttgtccggtgaagacttaactttggatgacatctcactaaaggctgacttagaaaga
ttttttctgtcaatatattttttctatgcatcaaggcccgaatattcatgtactttctgg
tctgataaggaatcaaacgcttatggttttattgagtggtgttcgagatgcaacgacaac
ttgatgaggtcttgtttctatttgatggtttctagcttgtcctttggtcctgaaaatgcc
ctgaatgtctatcactattttggcgaaaacagctcgatttcatggaaaaacattgcacag
tgtctcagtgactacactaagaaaataagcaattttaactcgagcctccataagaggcag
cagtttagtgagtcaactcataacgatatcgattcgactgcggtagccttagaagaaggc
ttaaatgaagaagctgtaatatttctgtcttctttattaactttagttggatcagttaca
taccaggttgacgaggatgtaaaaagctcgctatcgaaagttttctcagatgtcctattc
gaattcaccaagataaatacacctctcgtaggcgctgctttcaaggttataagtaacttg
gttccaaaacttgaatcttctagaacaaaattttggtcttttctagactctctaattttc
aaggattcatcgctgaattattcatccgaatcttatagaaatgcttttacaaacgtgtta
acaaaatactctgacgttttggggtttttacaactcttccataatctgatttctattcat
tctcgtgaaaataatagtgaatacatggtttttggcaaattggcatttccaacaagatta
ggtcagggatataggaaggtaggtatatggccatattttgactacattttcaacgacatt
ttagcgcacgtggatcaaattgttgatatcagaaataaaagagccgtccagcttcctatt
ttgaaaattatctatacgggcttatgctcttttgattacagtgtaattttaaattctatt
cctgcagctgcgaatttggatgctttggtggattgcgaaaatttcttcaattacgttcaa
gaatgcccagctatccccatattcaactatattttcacggaaaagatttacaaaagtata
tttaatgtagttgatgttggtgttgatcaattgtccatagagttagaaggtggcaaaaat
caggctgaattgttgcagttagctgtgaaaattatcaataaagtattggattatcaggag
acatacgtggaagaattatttccaattgttaagaagcatggcaagacggattatttcttg
ccaaagaattattctcttcacggattacgttcattttacgatgcaatttttttcaatatt
ccacttgttgcacacttgggtttatacgtcggggtcgatgatcaaattttagccacaaat
tcactgcgtattttggcgaaactttcagaacgctctaatggctccgttgcgtctttgtct
aagagaaataagttgttaacaatattcgattccgtagatgaatcagccagaataaaggat
gcatttattacacaattggaaagctcaataaccgacgctggtgtccttgctttgaagtta
gaactattagatttcttaacatcaaatctttctaattatagtcgaacgatgactatttct
catctgttattaggtttccaggtctcaaacgttatatccctgggacctaacctagcaaca
tttatatcttccggaacctcattacttgattccctcataagcgtgttggaagcttcattg
aacagcattactaaggacaatatcgattatgcacctatgagattggctacagcagcactg
gaaattattctcaaactatgtcgtaatccgttaacatctggtctactatattcataccta
atcaaagaaaacttttttgagagaataatgatcctcgatccacaagtgacaaggttcacg
acatggaacggctctccttttgacaattctacagaggaaaaatgtaagaacttcatcgag
agcgaatccgttggtgcatttctgtcattcttagcctacaggaattattggacacaatat
ttgggtctgttcattcataaaatttcattttcgggcacgaaatcagaggttttaacatat
gtgaattacttgatatcaaatacaatgtattcggtaaggttgttttctttcttggatcca
ttaaactatggcaatatctgcgaaccaaaagagacgttatcaattttcaccaatgttcct
ttaaatttggaacaagtcactcttaacaagtattgctccggcaatatctatgactttcac
aaaatggaaaaccttatgcgcctgattaaaagagtccgtgctgaaagcttacattctaat
tccttcagtctcactgtgtcaaaagaacaatttttgaaggatgcagatgtcgagtgtata
aaagcaaaaagccatttcacgaatattatatcaagaaacaaagcattggagttgaaccta
tctgtgctgcactcttgggtacagttggtgcaaatcattgttactgatggaaaattggaa
ccatcaacaagatcaaactttattctggaggtttttggtacaattattccgaagattagt
gattatattgagtttaatataactttttcagaagaattggtttctctcgccgttttccta
tttgatatatataaccgcgatcgtaagttgattaccgacaaaggcacggtagacggcagg
ctatatcagttgttcaagacatgtattcagggtataaactccccactctcctctgtggca
ttaaggtccgatttctatatattagcaaaccattatttgagtagagttctaagcgaccaa
gtagggtccgaaaaggttctgcaggatttgagactaggaagtaaaaaattggtagagatc
atatggaacgatgttgtttatggcgagggaactagtagggttacaggtatattactattg
gattcacttattcaactggctaatagaagtaaagagaattttatattggattcactgatg
aaaactacaagactgctcttaataatacgttcgctgaaaaatacagatgctttgttaaat
tctactacagagcacataaacattgatgatttgttatatgaattgacagcttttaaagcc
actgtattctttttaatacgtgttgccgaaactagaggtggagctagcgctttaattgaa
aataatctattccgaataatcgcggaattgtcatttttaaaagttgatcctgatttgggt
ctagaccttatgtttgacgaagtctacgttcagaattccaaattcttaaaggttaacgtc
accttggataatccgctactagttgacaaagatgctaatggtgtttccttgtttgagtta
atcgttcctatattccaattgatatcagctgttttagtgagcatggggagctcaaacaaa
gctgttgttcaaacggtaaagggtttactgaatacgtataagaggctagtgatcggaata
ttcaaaagagatcttttgagggaaaaagaagataagaaaaattcgtcggatcctaataac
caaagtttaaacgaaatggtgaagctaattgtgatgttatgcacattaacaggatatcaa
aataacgattaa

DBGET integrated database retrieval system