KEGG   Saccharomyces cerevisiae (budding yeast): YJL074CHelp
Entry
YJL074C           CDS       T00005                                 

Gene name
SMC3
Definition
cohesin subunit SMC3
Orthology
K06669  
structural maintenance of chromosome 3 (chondroitin sulfate proteoglycan 6)
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:sce04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:sce04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
X:complement(299157..302849)
Genome map
AA seq 1230 aa AA seqDB search
MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE
RQGLIHQGSGGSVMSASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTVGLKKDDYQLND
RNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKERLQLLEDVVGAKSFEVKLK
ASLKKMEETEQKKIQINKEMGELNSKLSEMEQERKELEKYNELERNRKIYQFTLYDRELN
EVINQMERLDGDYNNTVYSSEQYIQELDKREDMIDQVSKKLSSIEASLKIKNATDLQQAK
LRESEISQKLTNVNVKIKDVQQQIESNEEQRNLDSATLKEIKSIIEQRKQKLSKILPRYQ
ELTKEEAMYKLQLASLQQKQRDLILKKGEYARFKSKDERDTWIHSEIEELKSSIQNLNEL
ESQLQMDRTSLRKQYSAIDEEIEELIDSINGPDTKGQLEDFDSELIHLKQKLSESLDTRK
ELWRKEQKLQTVLETLLSDVNQNQRNVNETMSRSLANGIINVKEITEKLKISPESVFGTL
GELIKVNDKYKTCAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRLSLDS
DVKFPSNTTTQIQFTPLIKKIKYEPRFEKAVKHVFGKTIVVKDLGQGLKLAKKHKLNAIT
LDGDRADKRGVLTGGYLDQHKRTRLESLKNLNESRSQHKKILEELDFVRNELNDIDTKID
QVNGNIRKVSNDRESVLTNIEVYRTSLNTKKNEKLILEESLNAIILKLEKLNTNRTFAQE
KLNTFENDLLQEFDSELSKEEKERLESLTKEISAAHNKLNITSDALEGITTTIDSLNAEL
ESKLIPQENDLESKMSEVGDAFIFGLQDELKELQLEKESVEKQHENAVLELGTVQREIES
LIAEETNNKKLLEKANNQQRLLLKKLDNFQKSVEKTMIKKTTLVTRREELQQRIREIGLL
PEDALVNDFSDITSDQLLQRLNDMNTEISGLKNVNKRAFENFKKFNERRKDLAERASELD
ESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGTAKLIIHRKNDNANDHD
ESIDVDMDAESNESQNGKDSEIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALIL
AIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQFICTTFRTDMLQVADKFFRV
KYENKISTVIEVNREEAIGFIRGSNKFAEV
NT seq 3693 nt NT seq  +upstreamnt  +downstreamnt
atgtatatcaaaagggtgataattaagggttttaaaacctacaggaacgaaaccattatt
gataatttctcgccgcatcagaatgttattattggctccaatggttcaggtaaatcgaat
ttcttcgctgcgattagatttgttcttagtgacgattactctaatcttaagagggaagaa
aggcaagggcttatccaccaaggttctggtggttcagtgatgagtgcctcggtagaaatt
gtgttccacgatccagatcattctatgatattgccctccggtgtactttcgagaggagat
gacgaagtgaccattagaagaacagtagggctgaagaaggatgactatcaattaaatgac
agaaacgtgaccaaaggggacatagtcagaatgttggaaaccgctggtttttcaatgaat
aatccgtataatatagtaccacaaggtaaaatagtcgccttaactaatgccaaggataag
gaaagattgcagttattggaagatgttgtaggagctaagtcatttgaagtaaaattgaaa
gcttcattgaaaaaaatggaggaaacagagcagaaaaagattcaaattaacaaggaaatg
ggtgaactaaactctaaattgagtgaaatggaacaggaacgtaaggaattagagaaatac
aacgagttggaacgcaacagaaagatctaccagttcacattgtatgatcgagaattaaat
gaggttatcaatcaaatggaaagactggacggtgattataataacacggtatactcttcc
gaacaatacatccaggagttggataaaagagaggatatgattgaccaagtctccaaaaag
ctatcaagtattgaagcttcactgaagatcaaaaatgcgactgatttacaacaggcaaaa
ctacgggaatctgagatttctcagaaattaacaaacgtcaacgtaaaaataaaggatgtt
caacagcaaattgagtcaaatgaggagcagagaaatttggatagtgcaactttgaaagag
atcaaatctataattgagcaaaggaaacaaaagttgtctaaaattttacctagatatcaa
gaactcacaaaggaagaagcaatgtacaaacttcaattggcctccttgcaacaaaagcag
agagatcttatcttaaagaaaggagaatatgcccgttttaaatcaaaggatgaacgcgat
acgtggattcattcagaaattgaagaactgaaatcttcaatacaaaacttaaatgaactg
gaaagtcaattgcaaatggatcgtacttctttaaggaagcagtactctgcgattgatgaa
gagattgaagagctaattgattctatcaatggaccagataccaagggtcaattagaagat
tttgattcggaattaatacacctcaaacagaagctgagtgaaagtttagacactcgtaag
gaattgtggagaaaggagcaaaaattacagacagtcttggaaactttattaagtgacgtc
aatcaaaatcaaagaaatgttaatgaaaccatgagtagatcattggcaaatggtataata
aatgtgaaagaaattacagaaaaactaaaaatatcaccggaatctgtctttgggacatta
ggtgaactgattaaagtcaatgataagtacaagacatgtgctgaagtaattggaggtaac
tccctcttccacattgtcgtggataccgaagaaacggccactttgattatgaacgaacta
tatcgtatgaagggtgggagagtgacgtttattcccttgaacaggttatctttggacagt
gatgttaaattcccctcaaacactactacacaaatccagtttactcccttgataaagaag
ataaaatatgaacccaggtttgagaaggctgtcaaacacgtttttggaaaaactattgtt
gtcaaagacttaggtcaaggtttaaaattagctaagaaacacaaactcaatgccatcact
ttagatggtgatagagcagacaaaagaggtgtacttacaggtgggtatcttgaccagcac
aaacgaacacgtttggaatcattgaaaaacttaaatgaatcaagaagtcaacacaaaaaa
atactggaagaattagatttcgtaagaaatgaactaaatgatattgatactaagattgat
caagtaaacgggaatataagaaaggtttctaatgacagggagtctgtcttaacaaatatc
gaggtatatagaacatcgctaaacaccaaaaagaatgaaaaattaattctcgaagaatca
ttaaacgcaattatactaaaactagaaaagctgaatacaaatcgtacatttgctcaggaa
aagctaaatacattcgaaaatgatttgcttcaggagtttgatagcgaactctcaaaagaa
gaaaaggaaagattagaatctttaacaaaggagattagtgcagcgcacaataagctaaat
attacatcagacgccctagaaggtataactacaaccattgactcgttgaatgccgaattg
gagtccaaacttatcccacaagaaaatgatctagaatccaagatgtcagaagtaggtgac
gcatttatttttggtctacaagatgagttgaaagaattacaattggagaaggaaagcgtt
gaaaagcagcatgaaaacgctgtgttggaactaggtaccgttcaaagagaaattgaaagt
ctcattgctgaagaaactaataataagaaactgctagaaaaagcaaacaatcaacagcga
ttactattaaagaagcttgacaatttccaaaaaagtgttgaaaaaacgatgattaagaaa
acaactttggttactagaagagaagaattacagcaaaggattagggaaattgggcttctg
ccagaggatgctttagtaaatgattttagcgacatcacaagtgatcagctattacaaaga
ctgaatgatatgaacacagagatttctggtttgaagaatgtaaacaagagagcttttgaa
aacttcaaaaagtttaacgaaagacgcaaagaccttgcggagagagcttcagagctggat
gaatctaaagactcaattcaagatctaattgttaagttaaaacaacaaaaggttaacgcg
gttgattctactttccaaaaggtttctgaaaactttgaagctgtttttgaaagattagtt
cccagaggtactgctaagttgattattcaccgtaagaatgataacgctaacgaccatgat
gaaagtattgatgttgacatggatgcagaatccaatgaaagccaaaacggtaaagatagt
gaaattatgtatacaggtgtttcaatttctgtttccttcaattctaaacaaaacgaacaa
ctgcatgttgaacagctctcaggtggtcagaagactgtatgtgccattgctttgattctg
gcaatccaaatggttgaccctgcttccttctatctgtttgatgaaattgatgctgcactc
gacaagcagtatagaactgcagtcgctacacttctaaaagaactgtcaaaaaatgcccag
tttatttgtacgacgttcagaacagatatgttgcaagttgcagacaaatttttccgtgtt
aagtacgagaataagatttccacggttattgaggtcaatagagaagaagcaatcggattc
attagaggtagcaataaattcgctgaagtctaa

DBGET integrated database retrieval system