KEGG   Saccharomyces cerevisiae (budding yeast): YJL113WHelp
Entry
YJL113W           CDS       T00005                                 

Definition
gag-pol fusion protein (EC:3.1.26.4 2.7.7.7 2.7.7.49 3.4.23.-)
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
X:join(198678..198998,199000..203325)
Genome map
AA seq 1548 aa AA seqDB search
MNKLQKLVLMEKWIFSKCCQDCPNLKDYLQEAIMGTLHESLRNSVKQRLYNIPHDVGIDH
EEFLINTVIETVIDLSPIADDQIENSCMYCKSVFHCSINCKKKPNRELGLTRPISQKPII
YKVHRDNNHLSPVQNEQKSWNKTQKRSNKVYNSKKLVIIDTGSGVNITNDKTLLHNYEDS
NRSTRFFGIGKNSSVSVKGYGYIKIKNGHNNTDNKCLLTYYVPEEESTIISCYDLAKKTK
MVLSRKYTRLGNKIIKIKTKIVNGVIHVKMNELIERPSDDSKINAIKPTSSPGFKLNKRS
ITLEDAHKRMGHTGIQQIENSIKHNHYEESLDLIKEPNEFWCQTCKISKATKRNHYTGSM
NNHSTDHEPGSSWCMDIFGPVSSSNADTKRYMLIMVDNNTRYCMTSTHFNKNAETILAQV
RKNIQYVETQFDRKVREINSDRGTEFTNDQIEEYFISKGIHHILTSTQDHAANGRAERYI
RTIITDATTLLRQSNLRVKFWEYAVTSATNIRNYLEHKSTGKLPLKAISRQPVTVRLMSF
LPFGEKGIIWNHNHKKLKPSGLPSIILCKDPNSYGYKFFIPSKNKIVTSDNYTIPNYTMD
GRVRNTQNINKSHQFSSDNDDEEDQIETVTNLCEALENYEDDNKPITRLEDLFTEEELSQ
IDSNAKYPSPSNNLEGDLDYVFSDVEESGDYDVESELSTTNNSISTDKNKILSNKDFNSE
LASTEISISGIDKKGLINTSHIDEDKYDEKVHRIPSIIQEKLVGSKNTIKINDENKISDR
IRSKNIGSILNTGLSRCVDITDESITNKDESMHNAKPELIQEQLKKTNHETSFPKEGSIG
TNVKFRNTNNEISLKTGDTSLPIKTLESINNHHSNDYSTNKVEKFEKENHHPPPIEDIVD
MSDQTDMESNCQDGNNLKELKVTDKNVPTDNGTNVSPRLEQNIEASGSPVQTVNKSAFLN
KEFSSLNMKRKRKRHDKNNSLTSYELERDKKRSKKNRVKLIPDNMETVSAPKIRAIYYNE
AISKNPDLKEKHEYKQAYHKELQNLKDMKVFDVDVKYSRSEIPDNLIVPTNTIFTKKRNG
IYKARIVCRGDTQSPDTYSVITTESLNHNHIKIFLMIANNRNMFMKTLDINHAFLYAKLE
EEIYIPHPHDRRCVVKLNKALYGLKQSPKEWNDHLRQYLNGIGLKDNSYTPGLYQTEDKN
LMIAVYVDDCVIAASNEQRLDEFINKLKSNFELKITGTLIDDVLDTDILGMDLVYNKRLG
TIDLTLKSFINRMDKKYNEELKKIRKSSIPHMSTYKIDPKKDVLQMSEEEFRQGVLKLQQ
LLGELNYVRHKCRYDIEFAVKKVARLVNYPHERVFYMIYKIIQYLVRYKDIGIHYDRDCN
KDKKVIAITDASVGSEYDAQSRIGVILWYGMNIFNVYSNKSTNRCVSSTEAELHAIYEGY
ADSETLKVTLKELGEGDNNDIVMITDSKPAIQGLNRSYQQPKEKFTWIKTEIIKEKIKEK
SIKLLKITGKGNIADLLTKPVSASDFKRFIQVLKNKITSQDILASTDY
NT seq 4647 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacttcaaaagttggtactaatggaaaaatggattttttctaaatgctgccaa
gattgtcctaatctaaaggattacctacaagaagctatcatgggaaccttacatgaatcc
ttaagaaattctgtgaaacaacgtttgtacaacattccacatgacgtaggaattgatcac
gaagaatttctaatcaatactgttattgaaacagtaattgatttgagcccaattgcagac
gatcaaatagaaaatagctgcatgtattgcaaatctgttttccattgctcaattaactgc
aaaaagaaaccaaatagggaattaggcctgactcgaccaatttctcaaaaacctattatc
tacaaggtgcacagagacaacaaccacttaagtccagtgcaaaacgaacaaaagtcttgg
aacaagacacaaaaaaggtcgaacaaagtgtacaacagcaaaaaactggtaattattgat
accggttccggagtaaacattaccaatgacaaaaccttactgcataattacgaagacagt
aatcgcagtacacgattttttggtattgggaaaaacagttcagtgtctgttaaagggtat
ggctatataaaaatcaagaatggtcacaacaatactgacaataagtgtctattaacttac
tatgtaccggaagaagaatccactataatcagctgttatgacttagccaagaaaaccaaa
atggttttaagtcgaaaatataccagattgggaaacaaaatcataaaaattaaaaccaag
atagttaatggtgtcattcacgtaaaaatgaacgagttaattgaacgtccttccgatgat
tcaaaaataaatgcaataaaacctacttcttctcctggatttaaactaaataaaaggtct
attaccttggaagatgctcataaaagaatgggccatacaggaattcaacaaattgaaaat
tccataaaacataatcattatgaagaatcccttgacttaatcaaagaaccaaatgaattt
tggtgtcaaacctgtaaaatctctaaagccacgaaaagaaatcattataccgggtctatg
aataatcatagtactgatcatgaaccaggctcatcatggtgcatggatatatttggccct
gtatcaagttcaaacgcggacactaaaaggtacatgcttattatggtggataacaacacg
agatattgcatgacctccacacacttcaataagaatgctgaaactattttagctcaagtt
agaaagaatattcagtacgtggaaacacaatttgacaggaaagtcagagaaattaattca
gacagaggtactgaattcacaaatgatcagatagaagaatattttatttcaaaaggaata
catcacatacttacttctacacaagatcatgctgctaacggaagagcagaaagatacata
agaacaataataactgatgcaacaacactcctaagacaaagtaacttaagagtaaaattt
tgggaatacgcagtaacttctgctaccaatataagaaattacctggaacacaaaagtaca
ggtaaactaccattgaaggcaatctcacgtcaacctgtgacagtgagattaatgtcattc
ttaccatttggcgaaaaaggaataatttggaatcataatcacaaaaaattgaaaccatct
ggacttccttctataattctatgcaaagatccaaatagttatggatacaaattctttata
ccatccaaaaataaaattgtcacatctgataattatacaattcccaactatacaatggac
ggtagagtaagaaatactcagaatattaacaagagtcatcaattcagttcagataatgat
gatgaagaagatcaaatcgaaacggtcacaaacttatgtgaagctttggaaaactacgaa
gatgataataaaccaattactcgcctggaagatttgttcacagaggaagagttatctcaa
atagactcaaacgcaaaatacccatctcctagtaataacctagaaggggacttggattac
gtattttctgatgttgaggaatctggagattatgacgttgaatctgaactttcaacgaca
aataattcaatctcaactgataaaaacaaaattttgtcaaacaaggattttaattcagaa
cttgcatcgactgaaatatccatcagtggaatcgataagaaaggattaataaatacaagt
catattgatgaagataagtatgatgaaaaagtccacagaattccatcgattatacaagag
aaactggtaggaagtaaaaatactattaaaatcaatgacgaaaacaaaatctccgacaga
attcgtagtaaaaacattgggagtattttaaacactggactcagtagatgtgtagatatc
accgatgaatctattactaacaaagatgagtcaatgcacaacgcaaaacccgaactaatt
caggagcagttaaaaaaaacaaatcatgaaacttcgtttcctaaagaagggagcattgga
acaaatgtaaaattccgaaatacaaacaatgagatttctttaaaaacaggcgatacgagt
ttaccaataaaaactttagaaagcattaacaatcaccatagtaatgattattccacaaac
aaagttgaaaagtttgagaaggaaaatcatcatccgcccccgattgaggacattgtggat
atgagtgatcaaactgatatggaatcaaactgtcaggatggtaataacttaaaagaatta
aaagtcaccgataaaaatgtaccaactgacaatggaacaaatgtgtcaccaaggttggaa
caaaatattgaagcatctggatcaccagtacaaacagttaataaaagtgccttcttaaac
aaagaattcagttctttgaacatgaaaagaaaacggaaaagacacgataaaaacaatagt
ctaacaagctatgaattagaaagagataagaagcgttcaaaaaagaatcgagtgaaatta
attccagataatatggaaacagtttcagcaccaaaaattcgagccatatattataatgaa
gctatttcaaaaaatcctgacctcaaagaaaaacatgaatacaaacaggcatatcataaa
gaattacagaatttaaaagatatgaaggtatttgatgtcgatgtgaagtacagtagatca
gaaatccctgataatttaatagtacccaccaacacgatattcacaaagaaaagaaatggg
atttataaggctaggatagtctgcagaggtgatactcagtcaccagacacttacagtgta
ataactacagaatctttaaatcacaatcatattaagatattcttaatgattgcaaacaac
agaaatatgtttatgaagaccctggatatcaatcatgcattcctatatgctaaattggaa
gaagaaatatacatcccacatccgcatgataggagatgtgtagtcaagctaaataaggcg
ttatatggtctaaaacagagtcctaaagaatggaatgatcatctaagacaatacttgaat
ggaattggactgaaagataactcttatactccgggattataccaaaccgaggataaaaat
ctaatgattgcagtctatgttgatgactgcgtaattgcggcaagcaatgaacagagattg
gatgaattcataaacaaattgaaaagtaattttgaactgaaaattacaggaacattaata
gacgatgtactcgatacagatatattaggaatggatctagtatacaacaaaagacttggt
actatcgatttaacattaaaatcattcataaatagaatggataaaaaatacaacgaggaa
ttgaaaaagattagaaaaagttcaattccgcatatgtcaacttataaaatagatcctaag
aaagacgtactgcaaatgtcagaagaagagtttagacaaggtgttctaaagctacaacaa
ttactaggtgaactaaactatgtcagacacaaatgcagatacgacattgaatttgctgtt
aagaaagtggctagactagtaaattacccacatgaaagagtcttttatatgatttacaaa
ataatccagtacttggttcggtataaagatattggaatacactatgaccgagactgtaat
aaagacaaaaaggttattgctataactgatgcatcagttggatcagaatatgatgctcaa
tcaaggattggagttatattatggtacggtatgaatatttttaatgtttattctaacaag
agcacaaacagatgtgtatcatcaacagaagcagagcttcatgccatttatgaaggctat
gcagactcagaaacgttgaaggtaacattaaaggagctaggagaaggagacaataatgac
attgtcatgatcactgactcaaagccagccattcaaggattaaatcgcagctatcaacaa
ccaaaagagaaattcacttggataaaaactgaaataataaaagaaaaaattaaagagaag
agtataaaactgttaaaaattaccggcaaaggtaatattgctgatttactaacaaaacca
gtatcagcatctgattttaaaagatttatacaagtattaaaaaataaaataacatcacag
gatattttggcctcaacagactattga

DBGET integrated database retrieval system