KEGG   Saccharomyces cerevisiae (budding yeast): YJL114WHelp
Entry
YJL114W           CDS       T00005                                 

Definition
gag protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
X:197915..198595
Genome map
AA seq 226 aa AA seqDB search
MATPVRGETRNVIDDNISARIQSKVKTNDTVRQTPSSLRKVSIKDEQVRQYQRNLNRFKT
ILNGLKAEEEKLSEADDIQMLAEKLLKLGETIDKVENRIVDLVEKIQLLETNENNNILHE
HIDATGTYYLFDTLTSTNKRFYPKDCVFDYRTNNVENIPILLNNFKKFIKKYQFDDVFEN
DIIEIDPRENEILCKIIKEGLGESLDIMNTNTTDIFRIIDGLKKQI
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccccagtgaggggtgaaacaagaaatgttattgacgacaacatttctgcgcgg
attcaatcgaaagtcaaaacaaatgatactgtcagacagacgccatcatcattaagaaaa
gtttctattaaagatgaacaggtgagacaatatcaaagaaacttaaataggtttaaaacc
atactaaatggtttaaaggcagaagaggaaaaactttctgaggctgatgatattcagatg
ctagctgaaaaattattaaaactcggagaaaccattgacaaggttgagaataggattgtg
gatctagttgaaaagatacaattattggaaacaaacgagaacaataatatattacatgaa
catatagatgctacagggacttactatttattcgatacgttaacttcaaccaacaaaaga
ttctaccctaaggattgtgtttttgattataggactaataatgtcgagaacattcctatt
ctcttaaacaattttaaaaaattcatcaagaaatatcaatttgatgatgtctttgaaaat
gatatcatagaaatcgatcctcgtgaaaatgaaatcttgtgcaagataatcaaagaagga
ctcggtgaaagtttagatatcatgaacacaaatacaactgacatttttaggataatcgat
ggtttaaaaaaacaaatatag

DBGET integrated database retrieval system