KEGG   Saccharomyces cerevisiae (budding yeast): YJL139CHelp
Entry
YJL139C           CDS       T00005                                 

Gene name
YUR1
Definition
Yur1p (EC:2.4.1.-)
Orthology
K03854  
mannosyltransferase [EC:2.4.1.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
X:complement(151713..152999)
Genome map
AA seq 428 aa AA seqDB search
MAKGGSLYIVGIFLPIWTFMIYIFGKELFLIRKYQKIDSTYTALSQRVKEQYDTSRRRNY
FPKVKLSRNSYDDYTLNYTRQNDSDSFHLRENATILMLVRNSELEGALDSMRSLEDRFNN
KYHYDWTFLNDVPFDQDFIEATTSMASGKTQYALIPPEDWNRPQWINDTLFEERLRVMED
EGVLYGGSKSYRNMCRFNSGFFFRQSILDNYDYYFRVEPNVKYYCDFPYDPFRVMRLKGK
KYGFVISLYEYEETIPTLWDAVEEYLVASEETILRKEDSAYAFLTDSGLVGKHYPVVEAN
SDYNLCHFWSNFEIGDLNFFRSDEYKHFFETLDAKGGFYYERWGDAPVHSIGVSLLLRPD
EIIHFDELGYFHSPFGTCPASYAVRLDQRCRCKSDDESVIDITPHSCLMRWWKNGSGKYF
LKEEQDEI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggaggctcgctatacatcgttggcatattcttaccaatatggacctttatg
atctatatttttggcaaagagttattcctcatacgaaaataccaaaagattgacagtacg
tatactgctctttcccaaagagtaaaagaacaatatgatacaagtcgaagaagaaactat
tttcctaaagtaaaactttcccgcaatagctacgacgactacactttaaattataccaga
cagaatgattctgattcttttcacctacgagaaaatgcaacaattttaatgctggtgaga
aattcagaattagaaggggcattggattcaatgagatcattagaggacagatttaacaac
aagtatcattatgattggacttttctaaatgacgttcctttcgatcaagacttcattgaa
gctacaacatcaatggcgagtgggaagacccaatatgctttaataccaccagaagattgg
aatcggccgcaatggattaacgatacactttttgaagaaagacttcgagtcatggaggat
gagggtgttttatatgggggatccaagtcatatagaaatatgtgtcggtttaattctggt
ttttttttccggcagtcaatactggacaactatgattactactttagggtggaacccaat
gtcaagtattattgcgatttcccatatgacccgttcagagttatgagattgaagggcaaa
aaatacggatttgtcatatcattatatgaatatgaagaaaccataccaaccttatgggac
gcggtagaggagtatttagtggccagcgaagagaccattttacgtaaagaggacagtgcc
tatgcatttttgaccgattcagggctagttggtaagcattatcccgttgttgaagcaaac
tctgactacaatttgtgccatttttggtcgaattttgagattggcgacttgaatttcttc
agaagtgacgaatataagcatttttttgaaactttagatgccaagggcggattttactac
gaaaggtggggtgacgcacctgtacattcaattggtgtctccctactgctgagacctgac
gaaatcattcattttgacgaacttggctattttcactcaccgtttggcacctgtccagca
tcttacgctgttaggctcgatcagaggtgtagatgcaaaagcgatgatgaaagtgtcata
gatataaccccacatagttgtttgatgagatggtggaaaaacggtagcggcaaatatttc
ttaaaagaagagcaagacgagatttaa

DBGET integrated database retrieval system