KEGG   Saccharomyces cerevisiae (budding yeast): YJL157CHelp
Entry
YJL157C           CDS       T00005                                 

Gene name
FAR1
Definition
Far1p
Orthology
K06652  
cyclin-dependent kinase inhibitor FAR1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
MAPK signaling pathway - yeast
Cell cycle - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:sce04011]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:sce04111]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
X:complement(123836..126328)
Genome map
AA seq 830 aa AA seqDB search
MKTPTRVSFEKKIHTPPSGDRDAERSPPKKFLRGLSGKVFRKTPEFKKQQMPTFGYIEES
QFTPNLGLMMSKRGNIPKPLNLSKPISPPPSLKKTAGSVASGFSKTGQLSALQSPVNITS
SNKYNIKATNLTTSLLRESISDSTTMCDTLSDINLTVMDEDYRIDGDSYYEEDSPTFMIS
LERNIKKCNSQFSPKRYIGEKCLICEESISSTFTGEKVVESTCSHTSHYNCYLMLFETLY
FQGKFPECKICGEVSKPKDKDIVPEMVSKLLTGAGAHDDGPSSNMQQQWIDLKTARSFTG
EFPQFTPQEQLIRTADISCDGFRTPRLSNSNQFEAVSYLDSPFLNSPFVNKMATTDPFDL
SDDEKLDCDDEIDESAAEVWFSKTGGEHVMVSVKFQEMRTSDDLGVLQDVNHVDHEELEE
REKEWKKKIDQYIETNVDKDSEFGSLILFDKLMYSDDGEQWVDNNLVILFSKFLVLFDFE
EMKILGKIPRDQFYQVIKFNEDVLLCSLKSTNIPEIYLRFNENCEKWLLPKWKYCLENSS
LETLPLSEIVSTVKELSHVNIIGALGAPPDVISAQSHDSRLPWKRLHSDTPLKLIVCLNL
SHADGELYRKRVLKSVHQILDGLNTDDLLGIVVVGRDGSGVVGPFGTFIGMINKNWDGWT
TFLDNLEVVNPNVFRDEKQQYKVTLQTCERLASTSAYVDTDDHIATGYAKQILVLNGSDV
VDIEHDQKLKKAFDQLSYHWRYEISQRRMTPLNASIKQFLEELHTKRYLDVTLRLPQATF
EQVYLGDMAAGEQKTRLIMDEHPHSSLIEIEYFDLVKQQRIHQTLEVPNL
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaccaacaagagtttcgtttgaaaaaaaaatacacactccaccaagtggagat
cgtgacgctgaaagatcaccaccgaagaaatttctaagaggtttatcgggtaaagttttt
agaaagacaccagaatttaagaagcaacagatgcccacatttgggtatattgaagagagt
caatttactccaaatcttggcctaatgatgtccaaaagaggcaatattcctaaaccactg
aatctttccaagcctatatctcccccaccaagtttgaagaaaacagcgggatcagtagca
tctggtttttcgaaaacaggacaacttagcgctttacaatcgccagtaaatatcacaagt
agcaacaaatacaacatcaaagctacaaatttaactactagtttactccgagagtcgatt
tctgattctacaactatgtgtgatactttgtcagacatcaatttaacggttatggatgaa
gattatcgcattgacggcgattcatattacgaagaagattcaccaactttcatgatcagc
ctggaaagaaacataaaaaaatgcaattcacaattcagtccaaaaaggtacataggtgag
aaatgtttaatctgtgaggaaagtattagttccacatttaccggtgaaaaggttgtggag
tctacgtgttcacacactagccactataactgttatttgatgctatttgaaactctttat
ttccaaggcaagtttcctgagtgtaagatatgtggcgaagtgagcaagccaaaggataaa
gacattgttcctgaaatggtatccaaacttctaacgggcgcaggcgctcatgatgatggt
ccgtcatccaatatgcaacagcaatggattgatttgaaaacggcgagaagcttcacaggt
gaatttcctcagtttacaccacaggagcagctcattcgtactgctgatatttcatgtgat
gggttcaggacaccacgcttatcgaatagcaatcaatttgaggccgttagctatcttgat
agcccatttttaaattcaccattcgttaataaaatggcaactacagacccttttgattta
agtgatgatgaaaaactggactgtgatgatgaaatagacgaaagtgctgctgaagtgtgg
tttagtaaaacgggtggtgaacatgttatggtcagtgtgaagtttcaagaaatgcggacc
agtgatgatttaggggtcttgcaagatgtgaatcatgtggaccacgaagaactagaggaa
agggaaaaggaatggaaaaagaaaattgatcaatatatcgaaacaaatgtggataaggat
agcgaatttggcagtttgatcttgtttgacaaactaatgtattctgatgatggcgaacaa
tgggtagacaataaccttgtaatattattctccaaatttctagttttgtttgattttgaa
gaaatgaagatcctgggtaagattcctagagaccagttttaccaggtaatcaagttcaat
gaggacgtactactttgtagtttgaagagcactaatatacctgaaatatacttgaggttc
aacgaaaactgcgaaaagtggttgcttcccaaatggaagtattgtctagaaaattcttca
ctggagacactaccattaagtgagattgtttctacagtgaaggaactctctcatgtgaat
ataataggcgctttaggagcgccgcctgatgttatatcagcacaatcccatgattctcgt
ctaccgtggaaaagattgcacagtgatacgccgctaaaacttattgtatgtttgaatttg
tcgcatgctgatggggaactgtatcgcaagagagttctaaagagtgttcatcaaatattg
gatggattaaacacagacgatttactgggaatagttgttgttggaagagatggatccggt
gtagtaggcccatttggcaccttcatcggaatgataaataaaaattgggacggatggaca
actttcttggataatttagaagtggttaatccaaacgtcttccgcgatgaaaagcaacag
tataaggtaacattacaaacttgtgaaagattagcgtcaacaagtgcatacgtggataca
gatgaccatattgcaactggatacgccaagcaaatcttggtcctcaacgggagtgacgtt
gttgacattgagcatgatcagaaattaaaaaaggcctttgaccagttatcttaccattgg
agatacgaaatttcgcaacgccgcatgactccattgaacgctagcattaagcagttttta
gaggagctgcacactaagcgttatctagatgtaactcttcgtctaccacaagctacattc
gagcaagtatatttgggggatatggctgcgggtgaacaaaaaacgcgtctaattatggat
gaacacccgcattctagtttgatagaaatagaatattttgacctggtaaagcagcaaaga
attcatcagaccctggaagttcccaacctctag

DBGET integrated database retrieval system