KEGG   Saccharomyces cerevisiae (budding yeast): YJL164CHelp
Entry
YJL164C           CDS       T00005                                 

Gene name
TPK1, PKA1, SRA3
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit TPK1 (EC:2.7.11.11)
  KO
K04345  
protein kinase A [EC:2.7.11.11]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Meiosis - yeast
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    YJL164C (TPK1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     YJL164C (TPK1)
Protein kinases [BR:sce01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   YJL164C (TPK1)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     YJL164C (TPK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
X:complement(109966..111159)
Genome map
AA seq 397 aa AA seqDB search
MSTEEQNGGGQKSLDDRQGEESQKGETSERETTATESGNESKSVEKEGGETQEKPKQPHV
TYYNEEQYKQFIAQARVTSGKYSLQDFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKK
EIVVRLKQVEHTNDERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQ
RFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTY
TLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNAELR
FPPFFNEDVKDLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKEVVWEKLLSRNIETPYEP
PIQQGQGDTSQFDKYPEEDINYGVQGEDPYADLFRDF
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactgaagaacaaaatggaggtggtcaaaagtctctagatgatagacaaggtgag
gaatcacaaaaaggtgagactagtgaaagggaaacaacagccacagagagcggtaacgaa
agtaagtctgtagaaaaagagggtggagaaacccaagaaaaaccgaagcagccacatgtc
acttattacaatgaggagcagtataaacagtttattgcccaagcgagagttacaagtggg
aagtatagtttacaagactttcagatattaaggacactgggtacgggttcttttggtagg
gtccatttgattagatcaagacataatggcagatactacgccatgaaagttttgaaaaag
gaaatcgtggtaagattgaaacaggtggagcataccaacgacgagcgattgatgctttct
atcgtaacacatccgtttattattagaatgtgggggactttccaagatgctcagcaaatt
ttcatgattatggattatattgaaggtggagaattgttttctttgttaaggaaatcccaa
agatttcccaacccagttgctaaattttacgcagcggaagtttgtttagctttggagtac
ttgcatagcaaggacattatttatagggatttgaaaccggaaaatatcttgcttgataaa
aacgggcatataaagataacagatttcgggtttgccaaatacgttcctgacgtcacatat
acattatgcggtactcccgactacatagcacccgaggtcgttagtactaaaccatataat
aaatctatcgattggtggagtttcggtattctgatttacgaaatgctagcaggatacacg
ccattttacgactctaacacgatgaaaacctatgagaaaatcttgaatgccgaattgaga
tttccaccatttttcaacgaagatgtaaaggacctgttgagtagattgatcacaagagac
ttaagtcaaagactaggtaatttacaaaatggtacagaagatgtcaaaaaccacccctgg
ttcaaagaagttgtctgggaaaaattattatctagaaacatagaaacgccgtatgaaccg
cccattcaacagggacaaggtgacacctcacagttcgataagtacccggaagaagacatc
aactacggtgttcaaggtgaagacccatatgctgatcttttccgggacttctaa

DBGET integrated database retrieval system