KEGG   Saccharomyces cerevisiae (budding yeast): YJL187CHelp
Entry
YJL187C           CDS       T00005                                 

Gene name
SWE1, WEE1
Definition
(RefSeq) tyrosine protein kinase SWE1
  KO
K03114  mitosis inhibitor protein kinase SWE1 [EC:2.7.11.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Module
sce_M00693  Cell cycle - G2/M transition
Brite
KEGG Orthology (KO) [BR:sce00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    YJL187C (SWE1)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YJL187C (SWE1)
   04113 Meiosis - yeast
    YJL187C (SWE1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     YJL187C (SWE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr DUF4299 Kinase-like
Motif
Other DBs
NCBI-GeneID: 853252
NCBI-ProteinID: NP_012348
SGD: S000003723
UniProt: P32944
Position
X:complement(76803..79262)
Genome map
AA seq 819 aa AA seqDB search
MSSLDEDEEDFEMLDTENLQFMGKKMFGKQAGEDESDDFAIGGSTPTNKLKFYPYSNNKL
TRSTGTLNLSLSNTALSEANSKFLGKIEEEEEEEEEGKDEESVDSRIKRWSPFHENESVT
TPITKRSAEKTNSPISLKQWNQRWFPKNDARTENTSSSSSYSVAKPNQSAFTSSGLVSKM
SMDTSLYPAKLRIPETPVKKSPLVEGRDHKHVHLSSSKNASSSLSVSPLNFVEDNNLQED
LLFSDSPSSKALPSIHVPTIDSSPLSEAKYHAHDRHNNQTNILSPTNSLVTNSSPQTLHS
NKFKKIKRARNSVILKNRELTNSLQQFKDDLYGTDENFPPPIIISSHHSTRKNPQPYQFR
GRYDNDTDEEISTPTRRKSIIGATSQTHRESRPLSLSSAIVTNTTSAETHSISSTDSSPL
NSKRRLISSNKLSANPDSHLFEKFTNVHSIGKGQFSTVYQVTFAQTNKKYAIKAIKPNKY
NSLKRILLEIKILNEVTNQITMDQEGKEYIIDYISSWKFQNSYYIMTELCENGNLDGFLQ
EQVIAKKKRLEDWRIWKIIVELSLALRFIHDSCHIVHLDLKPANVMITFEGNLKLGDFGM
ATHLPLEDKSFENEGDREYIAPEIISDCTYDYKADIFSLGLMIVEIAANVVLPDNGNAWH
KLRSGDLSDAGRLSSTDIHSESLFSDITKVDTNDLFDFERDNISGNSNNAGTSTVHNNSN
INNPNMNNGNDNNNVNTAATKNRLILHKSSKIPAWVPKFLIDGESLERIVRWMIEPNYER
RPTANQILQTEECLYVEMTRNAGAIIQEDDFGPKPKFFI
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atgagttctttggacgaggatgaagaggacttcgaaatgctggacacggagaacctccag
tttatggggaagaagatgtttggcaaacaggccggcgaagacgagagtgatgattttgct
atagggggtagcaccccgaccaataaactgaaattttatccatattcgaacaacaaattg
acaagaagtacggggaccttgaacctgtcattaagtaatacagctttgtcagaggctaac
tccaaatttcttgggaaaattgaagaagaggaagaagaggaggaagaaggcaaggatgag
gaaagcgtggattctcgtattaaaaggtggtctccgttccatgaaaatgaaagtgttact
actcctattacaaaaagatctgcggaaaaaacgaacagtcctatttctctcaaacaatgg
aaccagcgatggtttccgaaaaatgatgctcgcactgaaaatacatcctcatcctcttca
tatagcgtcgctaaacctaaccaatcagcctttacgtcttcgggcctcgtatctaaaatg
tctatggacacttcgttataccctgcgaaattgaggataccagaaacaccagtgaaaaaa
tcacccttagtggagggaagagaccataagcatgtccacctttcgagttcgaaaaatgca
tcgtcttctctaagtgtttcccctttaaattttgttgaagacaataatttacaagaagac
cttttattttcagattctccgtcttcgaaagctttaccttccatccatgtaccaaccata
gactcatccccactgagcgaggcaaaatatcatgcacatgatcgtcacaataaccagaca
aacatcctgtctcccactaatagcttggttaccaacagctctccacaaacattgcattct
aacaagttcaaaaaaatcaaaagagcaaggaattcggttattttgaaaaatagagagcta
acaaacagtttacaacaattcaaagatgatttatacggcacggacgagaatttcccacct
ccaatcataatatcaagtcatcattcaactagaaagaaccctcaaccttatcaatttcgt
ggacgctatgacaatgacactgacgaagagatctccactccaacaagacgaaaatctatt
attggggcaacatctcaaacacatagagaaagcagaccattgtcactctcctctgccatc
gtgacaaacacaacaagtgcagagacgcattccatatcttccaccgattcttcgccgtta
aattccaaaaggcgtctaatctcttcaaataagttatcagcaaatccagattcccatctt
ttcgaaaaatttacgaatgtgcattccattggtaaaggccagttttccacggtctaccag
gttacgtttgcccaaacaaacaaaaagtatgcaatcaaagccattaaaccaaacaaatat
aattccttgaaacgcatattactggaaattaaaatactaaacgaggtaacaaaccaaatt
acaatggatcaagaagggaaggaatacatcatcgattacatcagttcctggaagtttcaa
aattcatactatattatgacagaattgtgcgaaaatggtaatttggatggatttttacaa
gagcaagttatcgcaaagaaaaaaaggttggaagattggagaatttggaaaatcatcgtg
gaattaagcctggctttacgattcatccatgattcttgtcacattgtgcatctggacttg
aaacccgcaaacgtcatgatcacatttgaaggtaacctaaaactaggtgactttggaatg
gctactcatttaccgttggaggataaaagttttgaaaatgaaggtgacagagaatatatt
gcaccagaaatcatttctgattgtacgtacgattacaaggcagatattttttccctgggt
ctgatgattgttgaaattgcagcgaacgttgtgttacctgacaatggcaacgcatggcat
aagttgagatcgggtgatttatcggatgcaggaagattaagttccacagatattcattct
gaatcattattttcagacattacgaaagtagatacaaatgatttatttgattttgaaaga
gacaatatcagtggtaatagtaacaacgctggcacctccactgttcataacaatagtaat
atcaacaaccctaatatgaataatggcaacgataataataatgtcaatactgccgctacc
aagaatcgtcttattttgcataaaagttctaaaattcccgcatgggtaccgaaatttctt
attgatggtgaatcacttgagagaatagtacgatggatgatagagcccaattatgagaga
aggcccacggcaaatcaaatcttacaaactgaggaatgcctgtatgtagaaatgacacgc
aatgcaggtgctattatccaggaagacgactttggacctaagccaaaattttttatatga

DBGET integrated database retrieval system