KEGG   Saccharomyces cerevisiae (budding yeast): YJL194WHelp
Entry
YJL194W           CDS       T00005                                 

Gene name
CDC6
Definition
AAA family ATPase CDC6
Orthology
K02213  
cell division control protein 6
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YJL194W (CDC6)
   04113 Meiosis - yeast
    YJL194W (CDC6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
X:69338..70879
Genome map
AA seq 513 aa AA seqDB search
MSAIPITPTKRIRRNLFDDAPATPPRPLKRKKLQFTDVTPESSPEKLQFGSQSIFLRTKA
LLQKSSELVNLNSSDGALPARTAEYEQVMNFLAKAISEHRSDSLYITGPPGTGKTAQLDM
IIRQKFQSLPLSLSTPRSKDVLRHTNPNLQNLSWFELPDGRLESVAVTSINCISLGEPSS
IFQKIFDSFQDLNGPTLQIKNMQHLQKFLEPYHKKTTFVVVLDEMDRLLHANTSETQSVR
TILELFLLAKLPTVSFVLIGMANSLDMKDRFLSRLNLDRGLLPQTIVFQPYTAEQMYEIV
IQKMSSLPTIIFQPMAIKFAAKKCAGNTGDLRKLFDVLRGSIEIYELEKRFLLSPTRGSL
NSAQVPLTPTTSPVKKSYPEPQGKIGLNYIAKVFSKFVNNNSTRTRIAKLNIQQKLILCT
IIQSLKLNSDATIDESFDHYIKAITKTDTLAPLQRNEFLEICTILETCGLVSIKKTKCKG
KTKRFVDKIDVDLDMREFYDEMTKISILKPFLH
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctataccaataactccaactaagcgtatcagaagaaatctatttgacgatgct
ccagcaacgcctccacgacctttgaaaagaaaaaagttgcagttcacagatgttacacca
gaatcatccccagaaaaactgcagtttggctcacagtctatttttttgaggacaaaggca
cttttgcagaagtcatctgagctagtcaacttgaatagcagcgatggtgcattgccagca
agaacagcagagtacgaacaagttatgaattttttggcgaaggcaatttctgaacacagg
tccgattcactgtacatcacgggtccgcctggcactggcaagactgcccagcttgatatg
attataagacagaagttccagtccctcccattgtcgctctccacgccacgctcgaaggac
gtgctgagacatacgaatccgaacttgcagaatttgtcctggtttgaattgcccgatgga
aggctagaatccgtggcggtaaccagtattaattgtatatcgttgggagagccgtcctcc
attttccagaagattttcgattccttccaagatctgaatggcccaacattgcaaataaaa
aacatgcagcatctacagaagttcttagagccttatcataagaaaactacgtttgtggtt
gtgttggacgagatggacaggctattgcatgctaacacgagcgagacacaatcagttaga
actattcttgaattattccttttggcgaaattgcctactgtgagttttgtgttaatcggt
atggctaatagtctagatatgaaagataggtttctttccaggttaaatttggacagaggg
ttgttaccgcaaactatagtttttcagccatacactgctgagcaaatgtatgaaatcgtc
attcaaaaaatgagtagtctgcccactattatcttccaaccgatggccatcaaattcgca
gcaaagaagtgtgctggaaatacgggtgaccttcgaaaactttttgatgtcttaagggga
agtatcgaaatctatgagttagaaaagcggtttctgctttcaccaacaagaggatcattg
aactctgcgcaagttcctttgacgccaactacttctccggtaaagaaatcgtatccagaa
ccacaaggtaaaataggcttgaactacatagccaaggtcttctcaaaattcgtgaacaat
aattctacgagaacgaggatagccaaactaaacatccagcaaaaattaattctttgcacc
ataattcaatcactgaagctaaattccgatgctacaatcgacgaatcgtttgatcattat
atcaaagcgataacaaaaactgatactttagcaccattgcagagaaatgaatttttggaa
atctgtacaattttagaaacttgtgggctggtttcaatcaaaaagacaaagtgtaaaggg
aaaaccaagagatttgttgataagattgatgttgatctcgacatgcgagaattttatgat
gagatgaccaaaatttcaattttgaaacctttccttcactag

DBGET integrated database retrieval system