KEGG   Saccharomyces cerevisiae (budding yeast): YJL197WHelp
Entry
YJL197W           CDS       T00005                                 

Gene name
UBP12
Definition
Ubp12p (EC:3.4.19.12 3.1.2.15)
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     YJL197W (UBP12)
Peptidases [BR:sce01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   YJL197W (UBP12)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
X:63805..67569
Genome map
AA seq 1254 aa AA seqDB search
MGSSDVSSRECSLVYNEDPDFTDGTTPCDRLGVDLMNVLDDKDEIKQESVPVSDREIEDT
ESDASAVSSFASANELIAEPHAASETNLGTNGQDGRNVLEQQRDVVARLIEENKETQKEG
DKVCIVPKVWYDKFFDPDVTDPEDIGPINTRMICRDFENFVLEDYNRCPYLSIAEPVFNF
LSEIYGMTSGSYPVVTNLVINQTTGELETEYNKWFFRLHYLTEKQDGRKRRHGQDDSIMY
LSMSALNLVRDLVEKSMNLFFEKADHLDVNAVDFKIWFVSEGSDIATDSNVSTFLNSSYE
ITPLQFLELPIKKLLIPDMFENRLDKITSNPSDLVIEIKPIEGNHHWPSNYFAYNKLEPA
SGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYEDEINEENPLGYHGYVARAFSDL
VQKLFQNRMSIMQRNAAFPPSMFKSTIGHFNSMFSGYMQQDSQEFLAFLLDSLHEDLNRI
IKKEYTEKPSLSPGDDVNDWNVVKKLADDTWEMHLKRNCSVITDLFVGMYKSTLYCPECQ
NVSITFDPYNDVTLPLPVDTVWDKTIKIFPMNSPPLLLEVELSKSSTYMDLKNYVGKMSG
LDPNTLFGCEIFSNQIYVNYESTESNAQFLTLQELIKPADDVIFYELPVTNDNEVIVPVL
NTRIEKGYKNAMLFGVPFFITLKEDELNNPGAIRMKLQNRFVHLSGGYIPFPEPVGNRTD
FADAFPLLVEKYPDVEFEQYKDILQYTSIKVTDKDKSFFSIKILSVEKEQQFASNNRTGP
NFWTPISQLNLDKATDIDDKLEDVVKDIYNYSSLVDCAEGVLMQVDDEGDTEGSEAKNFS
KPFQSGDDEENKETVTNNENVNNTNDRDEDMELTDDVEEDASTEPELTDKPEALDKIKDS
LTSTPFAILSMNDIIVCEWSELGSNEAFSDDKIYNWENPATLPNKELENAKLERSNAKER
TITLDDCLQLFSKPEILGLTDSWYCPTCKEHRQATKQIQLWNTPDILLIHLKRFESQRSF
SDKIDATVNFPITDLDLSRYVVYKDDPRGLIYDLYAVDNHYGGLGGGHYTAYVKNFADNK
WYYFDDSRVTETAPENSIAGSAYLLFYIRRHKDGNGLGSSKLQEIIQKSRHGYDERIKKI
YDEQMKLYEFNKTDEEEDVSDDMIECNEDVQAPEYSNRSLEVGHIETQDCNDEDDNDDGE
RTNSGRRKLRLLKKVYKNNSGLGSSSTSEISEGCPENEVADLNLKNGVTLESPE
NT seq 3765 nt NT seq  +upstreamnt  +downstreamnt
atgggttcttcagatgtttcaagtcgtgaatgttcattggtttataatgaagatcccgat
ttcaccgatggcacaacaccatgtgatcggttgggagtggacttgatgaatgttctagat
gacaaggatgaaataaagcaagagtctgtcccagtctcagatcgtgaaattgaggatacg
gaatccgatgcttccgctgtttcttcatttgctagcgctaatgagttaatagctgagcca
cacgctgcaagtgaaactaatcttggaactaatggtcaagatggaagaaatgtcttagaa
caacaaagagacgtggttgctagactaatagaagaaaacaaggaaacgcaaaaagagggt
gataaagtctgtattgtccccaaggtttggtacgataaatttttcgaccccgatgttacc
gatcctgaagatataggccctattaatacacgcatgatttgcagagactttgaaaatttt
gtgcttgaggattacaatagatgtccgtatctgtctattgcagagcctgttttcaatttt
ctatcagaaatttacggcatgacaagtggctcttacccagtggtaactaatttggttatc
aaccaaaccacaggggagttagagacagaatacaataaatggtttttcagactacattac
ctgaccgaaaaacaagacgggaggaaaaggaggcatggccaggacgattcaataatgtac
ctctcgatgtctgcgttgaatttagtacgtgatttggttgaaaagagtatgaatctgttt
tttgagaaagctgatcatctagacgtgaatgcggtggattttaaaatttggtttgtgtca
gagggatctgatattgccacagatagcaatgttagtacttttttgaattcttcatatgaa
ataactccgcttcaatttctcgaactaccgataaagaaactactaataccagacatgttt
gaaaaccgtttagacaagataacttcaaatccgagtgaccttgtcatagaaattaaacct
atagaagggaatcaccattggccttcaaactattttgcttataataaactcgaaccagca
tcaggtactactggtttggtcaatttgggaaatacatgttacatgaattctgcgttgcaa
tgcctggtacacattccgcagttgcgtgattatttcctttatgatggttatgaagacgaa
atcaatgaagaaaatcctcttgggtaccacggctatgtggctagggcatttagtgacttg
gttcagaagttgtttcaaaacaggatgagcataatgcaaagaaatgctgctttcccccct
tcaatgttcaaatccactatcgggcactttaattcgatgttttctggttatatgcaacag
gattctcaagaatttttagccttcctgttagacagtttacatgaagatttgaacaggata
ataaagaaagaatacacagaaaaaccatcattatctcctggtgatgacgtgaatgattgg
aatgtagtcaagaaactggcagacgatacttgggagatgcatttaaagagaaattgttcc
gttataacggatttatttgtcgggatgtacaaatcaacgctatattgtcccgaatgtcaa
aatgtttctataacgtttgacccgtataatgatgttacattgccgcttccggttgataca
gtgtgggataaaactataaaaatttttcccatgaactctccaccacttcttcttgaagtt
gagttaagcaaatcgtccacttatatggacttgaagaattatgttggtaaaatgtcgggc
ctagatccaaatacactatttggctgtgagattttcagtaatcaaatctatgttaactat
gagtcaacagagtcgaatgctcaatttttaaccttgcaggaattgatcaaacctgctgat
gacgttattttttatgaattaccagtaacaaatgacaatgaagtaattgttcccgtattg
aatactagaattgaaaaaggctacaaaaatgcaatgttatttggagtccctttctttatt
acgttaaaagaagatgaattgaataatccaggtgcaataagaatgaaattgcaaaacagg
tttgtccatttaagtggtgggtatatcccatttcctgaacctgtaggaaatcgaaccgat
tttgctgatgcttttccattattagtagaaaaatatccagatgttgaatttgaacaatat
aaagatatactacagtatacgtctattaaggtgactgacaaggataaatcctttttttcc
atcaagattctgtctgtagaaaaagagcagcaatttgctagtaataaccgaacagggcct
aatttctggacccctatctcccagttaaaccttgacaaagctacagatatagacgataaa
cttgaagatgtggtgaaggatatctacaattattcatccttagtagattgtgctgaaggg
gtccttatgcaagtggatgatgagggagataccgagggtagtgaagcaaagaatttttcc
aagcccttccaatcgggagatgatgaagaaaataaagaaactgtaacaaataatgaaaat
gtaaataatactaatgatcgggatgaagatatggaactaacagatgatgttgaagaagat
gcaagtacagagccagaattaacagataagccagaggcgttagataaaattaaggatagc
ttgacttccactccgtttgcgattctttctatgaatgatattattgtttgtgagtggagc
gaattgggttcaaatgaggcattttccgatgataaaatatataactgggaaaatccagct
actttgcctaacaaagagttggagaacgctaagttggaaagatctaacgctaaggaaaga
accataaccttggacgattgtctccaattattttccaaaccagaaatactaggattaacc
gattcgtggtactgccctacatgcaaggaacatcgtcaggctaccaaacaaatacaactt
tggaatacaccagatattctgctaattcaccttaaaaggtttgaaagtcaaaggtctttt
agcgataaaattgatgccacggttaatttccccattacagatttggatctgtcgaggtac
gttgtctataaagatgatcccagaggtttaatctatgacctgtatgcagtagataaccac
tatggtggtttgggtggtgggcactataccgcgtacgtaaagaattttgccgacaataaa
tggtactattttgatgattctcgagtaactgaaactgcgccagaaaatagtatagctgga
tcggcttatttgctattttacattcgccgtcataaagatggcaatggattaggcagctct
aaactacaggaaataatccaaaagtcacgccacggatatgatgagcgtatcaaaaagata
tacgatgaacagatgaagttgtatgaatttaataagactgacgaggaggaagatgtttct
gatgatatgatagaatgtaatgaagatgtgcaggcccctgaatatagtaatcgtagtttg
gaggttgggcatattgaaactcaggactgcaacgacgaagatgacaatgatgatggtgag
aggacaaattcaggtaggagaaagttaagattgttgaaaaaagtctacaagaataattca
ggcttgggttcatcgagtacgtctgaaatatctgagggatgcccagaaaacgaagtcgct
gatttgaatttaaaaaatggtgtgacactagaatcgccagaataa

DBGET integrated database retrieval system