KEGG   Saccharomyces cerevisiae (budding yeast): YJL200CHelp
Entry
YJL200C           CDS       T00005                                 

Gene name
ACO2
Definition
(RefSeq) aconitate hydratase ACO2
  KO
K17450  
homoaconitase [EC:4.2.1.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Lysine biosynthesis
Metabolic pathways
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Lysine biosynthesis, AAA pathway, 2-oxoglutarate => 2-aminoadipate => lysine
Lysine biosynthesis, 2-oxoglutarate => 2-oxoadipate
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    YJL200C (ACO2)
Enzymes [BR:sce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-  
     YJL200C (ACO2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
SGD: 
UniProt: 
Position
X:complement(56444..58813)
Genome map
AA seq 789 aa AA seqDB search
MLSSANRFYIKRHLATHANMFPSVSKNFQTKVPPYAKLLTNLDKIKQITNNAPLTLAEKI
LYSHLCDPEESITSSDLSTIRGNKYLKLNPDRVAMQDASAQMALLQFMTTGLNQTSVPAS
IHCDHLIVGKDGETKDLPSSIATNQEVFDFLESCAKRYGIQFWGPGSGIIHQIVLENFSA
PGLMMLGTDSHTPNAGGLGAIAIGVGGADAVDALTGTPWELKAPKILGVKLTGKLNGWST
PKDVITKLAGLLTVRGGTGYIVEYFGEGVSTLSCTGMATICNMGAEIGATTSTFPYQEAH
KRYLQATNRAEVAEAADVALNKFNFLRADKDAQYDKVIEIDLSAIEPHVNGPFTPDLSTP
ISQYAEKSLKENWPQKVSAGLIGSCTNSSYQDMSRVVDLVKQASKAGLKPRIPFFVTPGS
EQIRATLERDGIIDIFQENGAKVLANACGPCIGQWNREDVSKTSKETNTIFTSFNRNFRA
RNDGNRNTMNFLTSPEIVTAMSYSGDAQFNPLTDSIKLPNGKDFKFQPPKGDELPKRGFE
HGRDKFYPEMDPKPDSNVEIKVDPNSDRLQLLEPFKPWNGKELKTNVLLKVEGKCTTDHI
SAAGVWLKYKGHLENISYNTLIGAQNKETGEVNKAYDLDGTEYDIPGLMMKWKSDGRPWT
VIAEHNYGEGSAREHAALSPRFLGGEILLVKSFARIHETNLKKQGVLPLTFANESDYDKI
SSGDVLETLNLVDMIAKDGNNGGEIDVKITKPNGESFTIKAKHTMSKDQIDFFKAGSAIN
YIGNIRRNE
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgctatcttcagctaataggttttatataaagaggcatttggcaacacatgccaatatg
ttcccctctgtatctaaaaattttcaaacaaaagtgccaccttatgcaaaacttttgacc
aacctagacaagattaaacaaataacaaacaatgctccattgacactagcagaaaaaatt
ttatactcgcatctttgcgatcctgaagaatcgattacttcttctgatctgtccaccatc
cgtggtaataaatacttgaagctaaacccagaccgtgtagctatgcaggacgcttctgcc
caaatggcgcttctacaattcatgaccaccggtctaaatcaaacatctgtcccagcatcc
atacattgtgatcatttaattgtaggtaaggacggtgaaactaaagatttaccctcttcc
atagctaccaaccaagaagttttcgatttcttggagagttgcgcaaagagatatggaatt
caattctggggcccaggttctggtatcattcaccagattgttttggaaaatttctcagct
ccaggtctaatgatgctaggtactgattcccatacaccaaatgcaggcggtctgggagct
attgccatcggggttggtggtgcggatgcagttgatgccctcacaggcactccatgggaa
ttaaaagcaccaaaaattttaggtgttaaattgaccggaaagttaaacggatggtccact
cctaaagatgtaatcacaaagctcgctggtttactaactgtcagaggtggtactggttat
atcgtcgagtacttcggcgaaggtgtatccactctatcttgcacaggtatggcaaccatc
tgtaatatgggagctgaaatcggtgctacaacgtcaactttcccttaccaagaagctcac
aagcgttatttgcaagcaactaatagagcagaggtcgctgaagcagctgatgttgcttta
aacaagtttaacttcttaagagccgacaaagatgctcaatacgataaagttattgaaatt
gacttatccgcaattgaacctcacgttaatggtccatttacaccagacctttcaacccca
atatctcaatatgccgaaaaaagtttgaaggaaaactggccccaaaaagttagcgctggt
ttgattggatcatgtaccaattcatcttatcaagacatgagtcgtgttgtcgacttggtc
aagcaagcttccaaagccggcttgaaaccacgtatccccttctttgtcacccctggttca
gaacaaattagagctaccttggaaagagatggaatcatcgatattttccaagaaaatggt
gccaaagttttagcaaatgcatgcggcccttgtatcggacaatggaatagggaagatgtc
tcgaaaacatcaaaagaaacgaacactatttttacatcattcaatagaaatttcagagct
agaaacgatggtaataggaatacaatgaatttcttaacatccccagaaatagtaacagcg
atgagttattctggagatgctcagttcaatccgctaactgactcaattaaattgccaaat
gggaaggatttcaaattccaaccaccaaagggtgatgagttaccaaaaagaggatttgaa
cacggtagagacaaattttatcctgaaatggatccaaagccagatagcaatgtagagatt
aaggtagaccctaattctgatcgtttgcaattattagagccattcaaaccttggaacggg
aaggaattgaagacaaacgtgcttttgaaagttgaaggtaaatgtacaacagatcatatt
tccgctgcgggcgtctggttgaaatataaaggccatctagaaaacatttcttacaataca
ttgattggtgcacaaaacaaagaaaccggtgaagtcaacaaggcttatgaccttgacgga
actgaatatgatattcctggtttgatgatgaaatggaaatcagacggtagaccatggacc
gtgatagcggaacataactatggtgaaggttccgcaagagagcatgctgctttgtcacca
agatttttaggcggagagattcttttagttaagtcttttgcaagaattcatgagacaaac
ttgaagaaacaaggtgtgttgccattgacttttgccaacgaatctgactatgataaaata
tcaagcggagatgttttagaaacgttgaacctagttgacatgattgctaaggatggtaat
aacggtggtgaaattgatgttaaaattactaaaccaaacggtgaatcgttcaccatcaag
gcaaaacatactatgtctaaagatcaaatcgattttttcaaagctggttcagcaatcaat
tatattggtaatatacgaagaaacgaataa

DBGET integrated database retrieval system