KEGG   Saccharomyces cerevisiae (budding yeast): YJL216CHelp
Entry
YJL216C           CDS       T00005                                 

Gene name
IMA5
Definition
Ima5p (EC:3.2.1.10 3.2.1.20)
Orthology
K01187  
alpha-glucosidase [EC:3.2.1.20]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sce00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sce00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
X:complement(24341..26086)
Genome map
AA seq 581 aa AA seqDB search
MTIIHNPKWWKEATVYQIYPASFKDSNNDGWGDLAGITSKLDYVKELGVDAIWVCPFYDS
PQEDMGYDIANYEKVWPRYGTNEDCFQMIEEAHKRGIKVIVDLVINHCSEEHEWFKESRS
SKANPKRDWFFWRPPKGYDEKGNPIPPNNWRSFFGGSAWRYDEKTGEFFLHVFALGQPDF
NWENEECRKAIYDSSVGYWLRHNVDGFRIDVGSMYSKVEGLPDAPITDPTVPYQKGTEFF
INGPRIHEYHKEMHNYMLSQVPEGKEIMTVGEVGIGNEDDFRVYTSAKEGELNMMFNFKH
TSVGENPKCKYELIPFTLKDFKLALAESFLFIENTDCWSTIYLENHDQPRSVSRFGSDSP
KWREISSKMLATLIISLTGTVFIYQGQELGMPNFKNRKIEQIKCVEGTGTYAAIKRDYGE
DSEKMKKFFEALALISRDHGRTPFPWSADEPSAGFSKDAKPWIDMNESFRDGINAEAELK
DKNSVFFFWKKALQVRKEHKDILVYGHNFQFIDLDNDKLFMFTKDTDNKKMFAVFNFSSD
NTDFSVPDNEASYTMFFGNYANSNGDSRTLQPWEGRLYLLK
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcatccataatcctaaatggtggaaagaagccaccgtctaccaaatttatcct
gctagtttcaaggactccaacaatgacggatggggtgatttagctgggattacctccaaa
cttgactatgtcaaagaattaggtgtcgatgcgatatgggtgtgcccattttatgactct
cctcaagaagatatgggttacgatattgccaactatgagaaggtttggccacgttacggt
accaatgaggattgtttccaaatgatagaagaagctcataagagaggtatcaaggttatt
gttgacctggttatcaaccactgttctgaagagcatgaatggttcaaggagagtagatct
tctaaggctaatccaaagcgtgactggtttttctggagacctccaaagggttacgatgag
aaaggtaatccaattcctcccaacaattggagatctttctttggtggatctgcttggaga
tatgacgaaaaaactggtgagttctttctgcatgtgtttgctcttggccaacctgatttc
aattgggaaaatgaagagtgccgtaaagccatttatgactcctcagtgggctattggcta
cgtcacaacgttgatggctttcgtattgacgtaggcagcatgtattctaaggttgagggc
ctacccgatgctcctatcactgatcctacagttccttaccaaaaaggaactgaatttttc
ataaatgggccacgtatccatgagtatcataaagaaatgcataactacatgctctcgcaa
gttccagagggtaaagaaatcatgactgttggagaagttggtatcgggaatgaagacgac
ttcagagtttataccagtgccaaagaaggagaactaaatatgatgttcaacttcaagcac
acctcagtaggtgaaaacccaaaatgcaagtacgaacttattccctttactttaaaagac
tttaagctggctcttgctgaaagctttctgtttatcgaaaacacagattgctggtcgacc
atctatttggagaatcatgatcaacctcgtagcgtttcgcgttttggctcagattctcct
aaatggcgtgagatttcgtccaagatgttggctactctcatcatttcattgactggtact
gtttttatctaccaaggacaagaattgggtatgcccaacttcaaaaacagaaaaattgag
caaatcaaatgcgttgaaggtactggtacatatgccgccattaaacgtgattatggtgaa
gattctgaaaagatgaaaaagttttttgaagcattagctttgatctctagagatcatggg
agaacaccattcccatggagtgctgatgagccttctgcaggtttctcgaaggatgccaaa
ccatggattgacatgaatgaatcatttagagacggaatcaacgcagaagctgagttaaaa
gataaaaactcagtcttctttttctggaaaaaggccttacaagttagaaaggagcacaaa
gatatccttgtttatggacataactttcagttcattgatcttgataatgacaagctattc
atgtttacaaaggacacagataacaaaaaaatgtttgctgttttcaatttcagtagcgat
aatacggacttttcagttcctgataatgaggcctcctacaccatgttttttggcaactat
gcaaactcaaatggtgattcccgcaccttgcagccatgggaaggaagactttacttgttg
aagtaa

DBGET integrated database retrieval system