KEGG   Saccharomyces cerevisiae (budding yeast): YJR021CHelp
Entry
YJR021C           CDS       T00005                                 

Gene name
REC107, MER2
Definition
Rec107p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
X:complement(join(468555..469183,469264..469579))
Genome map
AA seq 314 aa AA seqDB search
MVARGRTDEISTDVSEANSEHSLMITETSSPFRSIFSHSGKVANAGALEESDKQILEWAG
KLELESMELRENSDKLIKVLNENSKTLCKSLNKFNQLLEQDAATNGNVKTLIKDLASQIE
NQLDKVSTAMLSKGDEKKTKSDSSYRQVLVEEISRYNSKITRHVTNKQHETEKSMRCTQE
MLFNVGSQLEDVHKVLLSLSKDMHSLQTRQTALEMAFREKADHAYDRPDVSLNGTTLLHD
MDEAHDKQRKKSVPPPRMMVTRSMKRRRSSSPTLSTSQNHNSEDNDDASHRLKRAARTII
PWEELRPDTLESEL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggtcgctagaggtagaacagacgagatatctacagatgtttcagaggctaattctgaa
cactcgttgatgattacagaaacatcatcaccgttcagatctatattctcccacagtggg
aaagtagcgaatgcaggcgctttagaggaatcggacaagcagatactggaatgggcaggt
aaactggaattggagagtatggagctgagggaaaactctgacaagctaattaaagtttta
aatgaaaattctaagacattatgtaaatcgctaaacaagtttaaccagctactggaacaa
gatgctgctacgaacggaaacgtgaaaaccttaataaaggatttggcttcccagattgaa
aaccaactggacaaagtgtcaacagcaatgttatcgaaaggcgacgagaagaagacaaag
tcggattccagctacaggcaggtattagtcgaagaaataagcaggtataattccaagata
acgcgacacgtaactaacaagcagcatgagacggaaaagtcgatgaggtgcacccaggag
atgctcttcaacgtcggcagccaactggaggacgtgcataaagtgctcctgtctctatcc
aaagacatgcacagtctacaaacccgccagactgctctagagatggcgtttcgagaaaag
gcagatcacgcctacgatcgcccggatgtgtctctgaatggcaccacactcctgcacgat
atggacgaagcccacgataagcagcgtaagaagtccgtgccgccaccaagaatgatggtc
acaaggtccatgaaacgcagaagatccagctccccaaccctatccaccagccaaaaccac
aatagcgaagacaatgatgacgctagccatcggctgaagcgtgcggccaggaccattatt
ccctgggaggaactaagacccgacactctggaatctgagctgtga

DBGET integrated database retrieval system