KEGG   Saccharomyces cerevisiae (budding yeast): YJR046WHelp
Entry
YJR046W           CDS       T00005                                 

Gene name
TAH11, CDT1, SID2
Definition
Tah11p
Orthology
K12414  
DNA replication licensing factor, required for pre-replication complex assembly
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:sce04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:sce04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
X:522048..523862
Genome map
AA seq 604 aa AA seqDB search
MSGTANSRRKEVLRVPVIDLNRVSDEEQLLPVVRAILLQHDTFLLKNYANKAVLDALLAG
LTTKDLPDTSQGFDANFTGTLPLEDDVWLEQYIFDTDPQLRFDRKCRNESLCSIYSRLFK
LGLFFAQLCVKSVVSSAELQDCISTSHYATKLTRYFNDNGSTHDGADAGATVLPTGDDFQ
YLFERDYVTFLPTGVLTIFPCAKAIRYKPSTMATTDNSWVSIDEPDCLLFHTGTLLARWS
QGMHTTSPLQIDPRANIVSLTIWPPLTTPISSKGEGTIANHLLEQQIKAFPKVAQQYYPR
ELSILRLQDAMKFVKELFTVCETVLSLNALSRSTGVPPELHVLLPQISSMMKRKIVQDDI
LKLLTIWSDAYVVELNSRGELTMNLPKRDNLTTLTNKSRTLAFVERAESWYQQVIASKDE
IMTDVPAFKINKRRSSSNSKTVLSSKVQTKSSNANALNNSRYLANSKENFMYKEKMPDSQ
ANLMDRLRERERRSAALLSQRQKRYQQFLAMKMTQVFDILFSLTRGQPYTETYLSSLIVD
SLQDSNNPIGTKEASEILAGLQGILPMDISVHQVDGGLKVYRWNSLDKNRFSKLLQIHKS
KQQD
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcacagctaatagtaggaggaaggaggttttgcgcgtgcctgtgatagatttg
aatagagtttcagatgaagagcagctgttgccggtggtgagggcaattttgctacagcat
gacacctttctgttaaaaaattatgctaacaaggctgttctagatgcactactagcgggg
ctcacgacaaaggacctgcctgacacgagtcaaggttttgatgcgaactttacgggtaca
ttaccgctagaagatgatgtttggctggagcagtacatatttgacactgatcctcaatta
cgcttcgatcggaagtgcaggaatgagtcactgtgctccatatatagtaggctgttcaaa
ctgggtctgtttttcgcccaactgtgtgtgaaaagtgtggtttctagcgcagaattgcaa
gactgtatcagcacctctcattatgcgactaagctgacccgttatttcaatgataatggt
agtacacacgatggtgcagatgcaggtgctaccgtgctgcccactggcgacgatttccag
tacctgtttgaaagggactatgttacttttcttccgacgggcgtgttgaccatcttcccc
tgtgccaaggctataaggtacaagccatcgactatggcgacgacggacaattcttgggtg
agtattgatgaacccgattgtcttctgttccacacggggaccctccttgcgcgctggtct
caaggtatgcacactacctcaccactccagatagatcctcgtgcgaacattgtttcgttg
accatctggcctccacttactacgccaatctcgagtaaaggagagggtacgattgccaat
catttgttggagcaacaaattaaggctttcccaaaagtcgctcagcaatactacccacgg
gagcttagtattctaagactccaagacgcaatgaagtttgttaaggagttgtttactgtt
tgcgagactgtattgtctttaaacgctctttccagatccacgggcgtcccaccagagctg
cacgttttgttaccccagatatccagcatgatgaaaaggaaaatagtgcaggatgatatt
ttgaagttattgaccatttggtctgatgcatacgtagtggaactgaactctagaggggag
ctgaccatgaatctacccaaaagagacaatctaacaacgttgaccaataagtctaggact
ttggcattcgtggaaagggcagagtcgtggtaccaacaagtgatagcttccaaggatgag
attatgactgatgtacccgctttcaaaataaataaaagaaggtccagctctaattctaaa
acagtcttgagcagtaaagtgcaaacgaagagctctaatgctaatgccttgaataactca
agatatttggcgaatagtaaggaaaatttcatgtacaaagagaagatgcctgattcgcaa
gcaaaccttatggacagactgcgtgaaagagagagacgttcggccgcattgctttctcaa
aggcaaaaacgttaccagcagtttctagcgatgaaaatgactcaggtatttgatattctt
ttttcgctgaccaggggccagccttatacagagacatatctaagctcgctaatcgtagat
agtttacaagatagtaataatcctatcggtacaaaagaagcaagtgaaattttagctggg
ctacaaggtatcctaccaatggacatatctgttcatcaagtggatggtgggttaaaagtt
tatagatggaacagtttggataaaaacagattttctaagctgttgcaaatccacaaatca
aaacaacaagattga

DBGET integrated database retrieval system