KEGG   Saccharomyces cerevisiae (budding yeast): YJR053WHelp
Entry
YJR053W           CDS       T00005                                 

Gene name
BFA1, IBD1
Definition
Bfa1p
Orthology
K02181  
cell cycle arrest protein BFA1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YJR053W (BFA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
X:534027..535751
Genome map
AA seq 574 aa AA seqDB search
MSIRPLTLNGLDEPETSFEELNTTLPRFQSHETLTLEENVPPLSTSTYIPPPSSVGTSDT
GTVFSNSTSAFWSNKQADDDQDMEVDQDDEFLNDFQEFQNKKDDFDDAIKTNFHLRNGCR
TGPFKNDIFAEEFDRKLSLEDKPRLKQPRSMMELKPKRKLSNSVTSRNLRSGNSVRFKKS
MPNLALVNPAIREEEEDEEREREDQREFNYKIDNDTQDTILAKFSSDDEGDFLTGFEELE
GEAIDETISSNDKESADHPRFLKKSSSSLPLKISPAQYDIVKHDELLTPGLHRRQRDWNT
QQELDSFKEKRSVRHCSNQNVQLNGPAKIKTIKQQIDHNTPMKKGSMIYNPKTMKWEGNE
NVLSKFSDVDTANRKALLIKNKLQRDADSKKQKYSDLQHARATSRNQKVIGNMILDEQNL
RWVSVSEEEADPFAGIPEINLPPVGKSMKKRSSSPFLRSKSQVNTPFVSNDNDGVYQSTA
AQARLRKYHSMRTLNGTTETPEISSTFHLSSRALEKFYHEENRWCKKLASWFIPRDETII
SVDEETIMDESTVNSKRKSYMYEIRNMVINSTKD
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattaggcctctcacgttaaacggtttagatgagccagaaacctcttttgaagaa
ctgaatacaactctacctcgctttcaatcccatgaaacattaactttggaagaaaacgtg
ccaccattgagtacatcaacttatataccgcctccatcctcggtaggtacttctgacact
ggcacggtattttccaatagtaccagcgcgttttggtctaataagcaagcagacgatgat
caggacatggaggtagaccaggatgatgaatttctaaatgacttccaggaattccaaaat
aaaaaggatgattttgacgatgctattaaaacaaattttcatttgagaaatggatgtcga
actggccctttcaaaaacgacattttcgcagaagagtttgatagaaaactgagtttggaa
gataaaccaaggctaaagcaacctagatcaatgatggaattgaaaccaaaaagaaaacta
tcaaatagcgtcacttcaagaaacttaaggtctggtaattctgtaagatttaagaaatct
atgcctaacttagctttagttaatccagctatcagagaagaagaagaggacgaagaacga
gaaagagaagatcaacgagagtttaattacaagattgataacgatacgcaggacacaatt
ttggcgaaattcagttcagatgatgaaggtgactttctgacaggatttgaagaattagag
ggtgaagcaattgatgaaacgatttcttcgaacgataaagaaagtgccgaccatccgcgt
ttcttaaagaagtcatcctcatctttgccattaaaaatatcacctgcacaatatgatata
gtaaagcatgacgaattattaactccaggtcttcataggcgacaacgagattggaatacc
cagcaggaactggactcttttaaagaaaaacgatcagtaagacactgttctaatcaaaat
gtacaactcaatggtccagctaaaatcaaaacaataaaacagcaaattgatcataatact
ccaatgaagaaaggttctatgatatataacccgaaaactatgaagtgggaaggaaatgaa
aacgtcttaagcaaatttagtgatgtagacacggcaaacaggaaagctttattgataaaa
aacaagctacaacgagatgcagattctaagaagcaaaaatattctgatctacagcatgca
agagccacttcgagaaatcaaaaggtcatcgggaacatgattttagatgaacaaaattta
agatgggttagtgtttcagaggaagaagcagacccttttgcaggcattcctgagataaac
ttaccaccagttggcaaaagtatgaaaaaacgtagctcctcaccatttttgcgttccaaa
agccaagttaatacgccatttgtttcaaatgacaatgatggcgtttatcaaagtacggct
gctcaagcaagactccgtaaataccattcaatgaggacacttaacggtacaacagaaact
ccagaaataagctctactttccatttgagttcaagagcattggaaaaattttaccacgag
gagaacaggtggtgtaaaaagttagcctcatggtttataccccgagatgagaccattatc
agtgttgatgaggaaacaatcatggatgaaagtacggtcaatagcaagagaaaatcctat
atgtatgaaatcaggaacatggtaatcaattcgacaaaagattag

DBGET integrated database retrieval system