KEGG   Saccharomyces cerevisiae (budding yeast): YJR066WHelp
Entry
YJR066W           CDS       T00005                                 

Gene name
TOR1, DRR1
Definition
Tor1p (EC:2.7.1.137 2.7.11.1)
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Protein kinases [BR:sce01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   YJR066W (TOR1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
X:559416..566828
Genome map
AA seq 2470 aa AA seqDB search
MEPHEEQIWKSKLLKAANNDMDMDRNVPLAPNLNVNMNMKMNASRNGDEFGLTSSRFDGV
VIGSNGDVNFKPILEKIFRELTSDYKEERKLASISLFDLLVSLEHELSIEEFQAVSNDIN
NKILELVHTKKTSTRVGAVLSIDTLISFYAYTERLPNETSRLAGYLRGLIPSNDVEVMRL
AAKTLGKLAVPGGTYTSDFVEFEIKSCLEWLTASTEKNSFSSSKPDHAKHAALLIITALA
ENCPYLLYQYLNSILDNIWRALRDPHLVIRIDASITLAKCLSTLRNRDPQLTSQWVQRLA
TSCEYGFQVNTLECIHASLLVYKEILFLKDPFLNQVFDQMCLNCIAYENHKAKMIREKIY
QIVPLLASFNPQLFAGKYLHQIMDNYLEILTNAPANKIPHLKDDKPQILISIGDIAYEVG
PDIAPYVKQILDYIEHDLQTKFKFRKKFENEIFYCIGRLAVPLGPVLGKLLNRNILDLMF
KCPLSDYMQETFQILTERIPSLGPKINDELLNLVCSTLSGTPFIQPGSPMEIPSFSRERA
REWRNKNILQKTGESNDDNNDIKIIIQAFRMLKNIKSRFSLVEFVRIVALSYIEHTDPRV
RKLAALTSCEIYVKDNICKQTSLHSLNTVSEVLSKLLAITIADPLQDIRLEVLKNLNPCF
DPQLAQPDNLRLLFTALHDESFNIQSVAMELVGRLSSVNPAYVIPSIRKILLELLTKLKF
STSSREKEETASLLCTLIRSSKDVAKPYIEPLLNVLLPKFQDTSSTVASTALRTIGELSV
VGGEDMKIYLKDLFPLIIKTFQDQSNSFKREAALKALGQLAASSGYVIDPLLDYPELLGI
LVNILKTENSQNIRRQTVTLIGILGAIDPYRQKEREVTSTTDISTEQNAPPIDIALLMQG
MSPSNDEYYTTVVIHCLLKILKDPSLSSYHTAVIQAIMHIFQTLGLKCVSFLDQIIPTIL
DVMRTCSQSLLEFYFQQLCSLIIIVRQHIRPHVDSIFQAIKDFSSVAKLQITLVSVIEAI
SKALEGEFKRLVPLTLTLFLVILENDKSSDKVLSRRVLRLLESFGPNLEGYSHLITPKIV
QMAEFTSGNLQRSAIITIGKLAKDVDLFEMSSRIVHSLLRVLSSTTSDELSKVIMNTLSL
LLIQMGTSFAIFIPVINEVLMKKHIQHTIYDDLTNRILNNDVLPTKILEANTTDYKPAEQ
MEAADAGVAKLPINQSVLKSAWNSSQQRTKEDWQEWSKRLSIQLLKESPSHALRACSNLA
SMYYPLAKELFNTAFACVWTELYSQYQEDLIGSLCIALSSPLNPPEIHQTLLNLVEFMEH
DDKALPIPTQSLGEYAERCHAYAKALHYKEIKFIKEPENSTIESLISINNQLNQTDAAIG
ILKHAQQHHSLQLKETWFEKLERWEDALHAYNEREKAGDTSVSVTLGKMRSLHALGEWEQ
LSQLAARKWKVSKLQTKKLIAPLAAGAAWGLGEWDMLEQYISVMKPKSPDKEFFDAILYL
HKNDYDNASKHILNARDLLVTEISALINESYNRAYSVIVRTQIITEFEEIIKYKQLPPNS
EKKLHYQNLWTKRLLGCQKNVDLWQRVLRVRSLVIKPKQDLQIWIKFANLCRKSGRMRLA
NKALNMLLEGGNDPSLPNTFKAPPPVVYAQLKYIWATGAYKEALNHLIGFTSRLAHDLGL
DPNNMIAQSVKLSSASTAPYVEEYTKLLARCFLKQGEWRIATQPNWRNTNPDAILGSYLL
ATHFDKNWYKAWHNWALANFEVISMVQEETKLNGGKNDDDDDTAVNNDNVRIDGSILGSG
SLTINGNRYPLELIQRHVVPAIKGFFHSISLLETSCLQDTLRLLTLLFNFGGIKEVSQAM
YEGFNLMKIENWLEVLPQLISRIHQPDPTVSNSLLSLLSDLGKAHPQALVYPLTVAIKSE
SVSRQKAALSIIEKIRIHSPVLVNQAELVSHELIRVAVLWHELWYEGLEDASRQFFVEHN
IEKMFSTLEPLHKHLGNEPQTLSEVSFQKSFGRDLNDAYEWLNNYKKSKDINNLNQAWDI
YYNVFRKITRQIPQLQTLDLQHVSPQLLATHDLELAVPGTYFPGKPTIRIAKFEPLFSVI
SSKQRPRKFSIKGSDGKDYKYVLKGHEDIRQDSLVMQLFGLVNTLLKNDSECFKRHLDIQ
QYPAIPLSPKSGLLGWVPNSDTFHVLIREHRDAKKIPLNIEHWVMLQMAPDYENLTLLQK
IEVFTYALDNTKGQDLYKILWLKSRSSETWLERRTTYTRSLAVMSMTGYILGLGDRHPSN
LMLDRITGKVIHIDFGDCFEAAILREKYPEKVPFRLTRMLTYAMEVSGIEGSFRITCENV
MRVLRDNKESLMAILEAFALDPLIHWGFDLPPQKLTEQTGIPLPLINPSELLRKGAITVE
EAANMEAEQQNETKNARAMLVLRRITDKLTGNDIKRFNELDVPEQVDKLIQQATSIERLC
QHYIGWCPFW
NT seq 7413 nt NT seq  +upstreamnt  +downstreamnt
atggaaccgcatgaggagcagatttggaagagtaaacttttgaaagcggctaacaacgat
atggacatggatagaaatgtgccgttggcaccgaatctgaatgtgaatatgaacatgaaa
atgaatgcgagcaggaacggggatgaattcggtctgacttctagtaggtttgatggagtg
gtgattggcagtaatggggatgtaaattttaagcccattttggagaaaattttccgcgaa
ttaaccagtgattacaaggaggaacgaaaattggccagtatttcattatttgatctacta
gtatccttggaacatgaattgtcgatagaagagttccaagcagtttcaaatgacataaac
aataagattttggagctggtccatacaaaaaaaacgagcactagggtaggggctgttcta
tccatagacactttgatttcattctacgcatatactgaaaggttgcctaacgaaacttca
cgactggctggttaccttcgagggctaataccttctaatgatgtagaggtcatgagactc
gctgcaaagactctgggcaagttagccgttccaggaggtacatatacctctgatttcgtg
gaatttgagataaagtcttgcttagaatggcttactgcctccacggaaaagaattcattc
tcgagttcgaagccagaccatgctaaacatgctgcgcttctgattataacagcgttggca
gagaattgtccttatttactctaccaatacttgaattccatactagataacatttggaga
gcactaagagacccacatttggtgatcagaattgatgcgtccattacattggccaaatgt
ctttccaccctacgaaatagggatcctcagttaactagccagtgggtgcagagattggct
acaagttgtgaatacggatttcaagtaaacacattagaatgcatccatgcaagtttgttg
gtttataaggaaatcttgtttttgaaggatccctttttgaatcaagtgttcgaccaaatg
tgtctaaattgcatagcttatgaaaatcataaagcgaaaatgattagagaaaagatttac
cagattgttcccctattagcatcgttcaatcctcaattatttgctggcaaatatttgcac
caaattatggacaactatttagagattttaaccaatgctccagcaaataaaataccacat
ctcaaagatgacaaaccacagattttaatatcgattggtgatattgcatatgaagtcggg
cccgatatcgcaccttatgtgaaacaaattcttgattatattgaacatgatttacagacg
aaattcaaattcagaaagaaatttgaaaatgaaattttctactgcatcggaagattggca
gttcccttgggccccgttctaggtaaattattaaacagaaatatactggacctgatgttc
aaatgccctctttccgactatatgcaggaaacgtttcaaattctgactgagagaatacca
tcactaggccccaaaataaatgacgagttgcttaacctagtctgttcaaccttatctgga
acaccatttatccagccagggtcaccaatggagataccatcgttttcgagagaaagagca
agagaatggagaaataaaaacatcctacagaaaactggtgaaagtaacgatgataataat
gatataaaaatcattatacaagcttttagaatgttaaaaaatatcaaaagcagattttcg
ttggtggaattcgtgagaattgttgcactttcttacattgagcatacagatcccagagta
aggaaactagctgcgttgacatcttgtgaaatttacgtcaaggataacatctgcaaacaa
acatcactacactctctgaacactgtatctgaagtgttatcaaagcttctagccattacg
attgcggaccctttacaagatatccgtttagaagttttaaagaatcttaatccatgtttc
gatccccagttggcacaaccagataatttgagactcttgtttactgcactgcacgatgag
tcgttcaatattcagtcagtagcaatggagcttgtcggtaggttgtcttccgtaaaccct
gcatacgtcatcccatcgataagaaaaatactactggaactgctaacaaaattaaaattc
tcaacttcttctcgagaaaaggaagaaactgccagtttgttatgtactcttatcaggtcg
agtaaagatgttgcgaaaccttatatcgaacctcttttaaatgttcttttaccaaaattc
caagatacctcttcaacggttgcatcaactgcactgagaactataggtgagctatctgtt
gtagggggcgaagatatgaagatatatcttaaggatttgtttcctttaattatcaaaaca
tttcaggatcaatcaaactctttcaagagagaagctgcacttaaggcccttggtcaactt
gcagcctcatctggttacgtgatagatcctttactcgactatcccgaattattgggtata
ttggtgaatatattgaagacagaaaactctcaaaatattaggagacaaacagtcactttg
ataggtatactgggagctatcgacccatatcgccaaaaagaacgtgaggttacctctact
accgatatatctacagaacagaacgccccgcctatcgacattgctcttctcatgcagggc
atgtctccttcgaatgatgagtattataccactgttgtcattcactgcctgctaaaaatc
ctaaaagatccatccctatcatcttaccacactgccgtgatccaagcgattatgcatatt
tttcaaacccttggtctaaaatgtgtttcattcttggaccagatcatcccaactattttg
gacgtaatgcgtacatgctctcagtcactattagaattttacttccaacagctttgctct
ttgattattatcgtaaggcaacacataagacctcatgtcgattctatattccaggctatc
aaagatttttcttcggttgctaagctacaaataacgcttgtaagtgttattgaagcaata
tcaaaggctctggagggtgaattcaaaagattggtccctcttactctgaccttgttcctt
gtaattttggagaatgacaagtctagtgacaaggtcctctccagaagggtattgagactg
ttagaatcgtttggtcctaacttagaaggttattcgcatttgattacacccaagatagtt
caaatggcagaattcaccagcgggaacctacaaaggtctgcaataattactattggcaaa
ctggccaaggatgttgacctttttgagatgtcctcaagaattgttcactctttacttagg
gtactaagttcaacaacgagtgacgaactctcaaaagtcattatgaatactttaagtcta
ctgctaatacaaatgggcacatcctttgctatcttcatccctgtcattaatgaagtttta
atgaagaaacatattcaacacacaatatatgatgacttgacaaacagaatattaaacaat
gatgttttacccacaaaaattcttgaagcaaatacaacggattataagcccgcggaacaa
atggaggcagcagatgctggggtcgcaaaattacctataaaccaatcagttttgaaaagt
gcatggaattctagccaacaaagaactaaagaagattggcaggaatggagcaaacgtcta
tccattcaattattaaaagagtcaccctcccatgctctaagagcttgttcaaatcttgca
agcatgtattatccactagccaaagaactttttaataccgcattcgcatgtgtttggacc
gaactttatagccaatatcaagaagatttaattgggtcattatgtatagccttatcttct
cccttaaatccaccagaaatacatcaaacattgttaaacctggtagaatttatggaacac
gatgacaaggcattaccaataccaactcaaagcctgggcgagtatgctgaaagatgtcac
gcctatgccaaagcgctacattataaagagattaaatttattaaagagcctgagaactca
actattgaatcattgatcagcattaacaaccagctgaatcaaacggatgctgcaattggt
atattaaagcatgcccaacaacatcattcacttcaattaaaggagacatggtttgaaaaa
ttagagcgttgggaagatgcactacatgcttataatgaacgtgaaaaggcaggtgatact
tccgtgagcgttacactcggtaagatgagatcccttcatgcccttggcgaatgggaacag
ttgtcgcaattggcagctagaaagtggaaagtttcgaagctacaaactaagaagctaata
gctcccttggcagctggtgctgcgtgggggttgggagagtgggatatgcttgagcaatat
atcagcgttatgaaacctaaatctccagataaggaattttttgatgcaattttatacttg
cacaagaatgattacgacaatgctagtaagcatatattaaacgccagagatttgcttgtg
actgaaatttccgcgttgatcaatgaaagttataatagagcatatagcgttattgttaga
actcaaataataacagagtttgaggaaatcatcaagtataaacaattgccacctaattcc
gagaaaaaacttcactatcaaaatctttggacaaaaagactgctgggctgccaaaaaaat
gtcgatttatggcaaagagtgcttagagtaagatcattggtaataaagcccaagcaagac
ctgcaaatatggataaaatttgcaaatttgtgcagaaaatctggtagaatgaggctagca
aataaggcattgaatatgctactagaaggaggcaacgatcctagtttaccaaatacgttc
aaagctcctcccccagttgtttacgcgcaactaaaatatatttgggctacaggagcttat
aaagaagcattaaaccacttgataggatttacatccaggttagcgcatgatcttggtttg
gatccgaataatatgatcgcgcaaagtgtcaaactctcaagtgcaagtactgctccgtat
gttgaggaatacacaaaattattagctcgatgttttttaaagcaaggtgagtggagaata
gcaacacaaccgaactggagaaacacaaatccggatgcaattcttggttcttatctattg
gctacacatttcgataaaaattggtacaaggcatggcataattgggccttagctaatttt
gaagtaatatccatggttcaggaagagactaagctcaacggaggtaagaatgatgatgat
gatgacacggcagttaataatgataatgtgcggattgacggtagtatcctaggaagtggt
tctttgactattaatggcaacagatacccgctagagcttattcaaagacatgttgttcca
gcgatcaagggcttttttcattcaatatctctattagaaacaagttgtttgcaagacacg
ttgaggttattgactcttttatttaactttggtggtattaaagaagtctcacaagccatg
tatgaaggcttcaatttgatgaaaatagagaactggcttgaagtcttaccacagttgatc
tctcgtatacatcagccagatcctacggtgagtaattcccttttgtcgttgctttctgat
ttagggaaagctcatccacaagctctcgtgtatcctttaactgtcgcgatcaagtctgaa
tctgtttcaagacaaaaagcggctctttcaataatagagaaaattaggattcatagtcca
gtcctggtaaaccaggcagaattagttagtcacgagttgatcagagtagccgttctatgg
cacgaattatggtatgaaggactggaagatgcgagccgccaatttttcgttgaacataac
atagaaaaaatgttttctactttagaacctttacataaacacttaggcaatgagcctcaa
acgttaagtgaggtatcgtttcagaaatcatttggtagagatttgaacgatgcctacgaa
tggttgaataactacaaaaagtcaaaagacatcaataatttgaaccaagcttgggatatt
tattataacgtcttcagaaaaataacacgtcaaataccacagttacaaaccttagactta
cagcatgtttctccccagcttctggctactcatgatctcgaattggctgttcctgggaca
tatttcccaggaaaacctaccattagaatagcgaagtttgagccattattttctgtgatc
tcttcgaagcaaaggccaagaaaattctccatcaagggtagcgacggtaaagattataaa
tacgttttaaagggacatgaagatataagacaagatagccttgttatgcaattatttggt
ctagttaacactttgttgaagaatgattcagagtgtttcaagagacatttggatatccaa
caatacccggctattccattgtcgcctaaatctggtttactaggatgggtaccaaatagt
gacacattccacgttttgatcagagaacaccgtgatgccaaaaaaattccgttgaacatt
gaacattgggttatgttacaaatggcccccgattatgagaatttgactcttttacaaaaa
attgaagtattcacgtacgctttagataatacaaaaggccaagacctttataaaatatta
tggttaaagagtaggtcgtcagagacatggctagaacgtagaacaacttatacgagatct
ttagcagttatgtccatgactggttatattctgggactaggtgatcgccatccaagcaac
ctgatgctagatagaatcaccggtaaagttatccacattgatttcggcgattgttttgaa
gctgccatcttaagagaaaagtatccagaaaaagtgccatttagactaactaggatgtta
acatacgcaatggaagttagtggaattgaaggcagtttccgaattacttgtgaaaatgtc
atgagagtcttaagagataataaagaatcattaatggcgatcttggaagcttttgcgctt
gatcctttgatccattggggatttgatttaccgccacaaaaacttactgagcaaactgga
attcctttgccgttgattaatcctagtgaattattaaggaagggggcaattactgtcgaa
gaagcggcaaatatggaagcagaacaacaaaatgagaccaaaaacgccagagcaatgctt
gttttgagacgtattacagataaattaacgggcaatgatatcaagaggttcaatgaatta
gacgtccctgagcaggttgataaactgatccaacaagccacttctattgaaaggttatgt
caacattatattggatggtgcccattctggtga

DBGET integrated database retrieval system