KEGG   Saccharomyces cerevisiae (budding yeast): YJR090CHelp
Entry
YJR090C           CDS       T00005                                 

Gene name
GRR1, CAT80, COT2, SDC1, SSU2
Definition
SCF ubiquitin ligase complex subunit GRR1
Orthology
K03360  
F-box and leucine-rich repeat protein GRR1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Ubiquitin mediated proteolysis
Module
SCF-GRR1 complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YJR090C (GRR1)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YJR090C (GRR1)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   SCF complex
    target recognizing subunit (F-box)
     YJR090C (GRR1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
X:complement(590872..594327)
Genome map
AA seq 1151 aa AA seqDB search
MDQDNNNHNDSNRLHPPDIHPNLGPQLWLNSSGDFDDNNNNNNNNNNNNSTRPQMPSRTR
ETATSERNASEVRDATLNNIFRFDSIQRETLLPTNNGQPLNQNFSLTFQPQQQTNALNGI
DINTVNTNLMNGVNVQIDQLNRLLPNLPEEERKQIHEFKLIVGKKIQEFLVVIEKRRKKI
LNEIELDNLKLKELRIDNSPQAISYLHKLQRMRLRALETENMEIRNLRLKILTIIEEYKK
SLYAYCHSKLRGQQVENPTDNFIIWINSIDTTESSDLKEGLQDLSRYSRQFINNVLSNPS
NQNICTSVTRRSPVFALNMLPSEILHLILDKLNQKYDIVKFLTVSKLWAEIIVKILYYRP
HINKKSQLDLFLRTMKLTSEETVFNYRLMIKRLNFSFVGDYMHDTELNYFVGCKNLERLT
LVFCKHITSVPISAVLRGCKFLQSVDITGIRDVSDDVFDTLATYCPRVQGFYVPQARNVT
FDSLRNFIVHSPMLKRIKITANNNMNDELVELLANKCPLLVEVDITLSPNVTDSSLLKLL
TRLVQLREFRITHNTNITDNLFQELSKVVDDMPSLRLIDLSGCENITDKTIESIVNLAPK
LRNVFLGKCSRITDASLFQLSKLGKNLQTVHFGHCFNITDNGVRALFHSCTRIQYVDFAC
CTNLTNRTLYELADLPKLKRIGLVKCTQMTDEGLLNMVSLRGRNDTLERVHLSYCSNLTI
YPIYELLMSCPRLSHLSLTAVPSFLRPDITMYCRPAPSDFSENQRQIFCVFSGKGVHKLR
HYLVNLTSPAFGPHVDVNDVLTKYIRSKNLIFNGETLEDALRRIITDLNQDSAAIIAATG
LNQINGLNNDFLFQNINFERIDEVFSWYLNTFDGIRMSSEEVNSLLLQVNKTFCEDPFSD
VDDDQDYVVAPGVNREINSEMCHIVRKFHELNDHIDDFEVNVASLVRVQFQFTGFLLHEM
TQTYMQMIELNRQICLVQKTVQESGNIDYQKGLLIWRLLFIDKFIMVVQKYKLSTVVLRL
YLKDNITLLTRQRELLIAHQRSAWNNNNDNDANRNANNIVNIVSDAGANDTSNNETNNGN
DDNETENPNFWRQFGNRMQISPDQMRNLQMGLRNQNMVRNNNNNTIDESMPDTAIDSQMD
EASGTPDEDML
NT seq 3456 nt NT seq  +upstreamnt  +downstreamnt
atggatcaggataacaacaaccacaatgacagcaataggctgcacccacctgatatacat
ccaaatttgggccctcaattgtggctgaatagtagcggtgattttgacgacaacaacaac
aacaacaacaacaacaacaataataatagcacaagaccacaaatgccatcacgaactaga
gaaacggcaacttcggaaagaaatgcaagtgaggttagggatgcaacgctaaataatatc
tttaggttcgatagtattcaacgggaaacgcttttgccaaccaacaacggacaaccgcta
aatcaaaacttttcgctgacatttcaaccacaacagcaaacaaatgcgctgaacgggatt
gacataaacactgtgaacacaaaccttatgaatggtgtcaatgttcaaatagatcaactt
aatcgattgttaccgaacctaccagaggaagaacggaagcaaatccacgaattcaagcta
atagtgggcaaaaaaatccaagagtttctggttgttatagagaaacgtagaaaaaaaata
ctgaacgaaattgagctagacaaccttaaactaaaggagctacgtattgataactcccca
caagcaattagttatttgcataaattacaaagaatgaggcttagggcgctagagacagaa
aacatggaaattagaaatttaaggctaaaaatattaacaattatagaagagtacaaaaag
tcattatatgcatactgccattccaagctaagaggtcaacaagtggaaaatccaacagat
aatttcatcatttggataaactccatagatactactgaatcatctgacttgaaagaaggg
ctacaagatctttcgagatattcaaggcagttcataaataatgtgctttcgaatccatca
aatcaaaacatatgtacgagtgtcacccgaagatcacctgtgtttgccctaaacatgcta
ccctcggaaatattacacttaatattagataaacttaaccaaaaatatgatattgtaaaa
ttccttaccgtttccaaactctgggctgaaataattgtgaagatactttattacagaccg
cacatcaacaaaaagagtcaattagacttgtttttaaggactatgaagttaacttctgaa
gaaactgtattcaactatcgtttaatgatcaaaagattaaatttttcatttgttggtgac
tacatgcacgatacagagcttaactattttgtcggatgtaagaatttggagcgactaact
ttagtattttgcaagcatataaccagtgttccaatatcggctgttttgagaggatgtaaa
tttctccaaagtgtggatatcactggaataagagacgtttccgatgacgtatttgatacc
ttagcgacatattgtcccagagtacagggcttttatgttcctcaggcaaggaatgtaaca
ttcgattcactgcggaatttcatagtccattccccgatgttgaaaagaataaaaatcaca
gcaaacaataacatgaatgacgaattagtagaactattagccaacaaatgccctttgctt
gtagaggtcgatataacattaagtccaaatgtcactgattctagtttgttaaaactcctc
actaggttagttcagctgagggaattcagaataactcataatacgaatattacggataat
cttttccaggagctttctaaagtagttgacgatatgccctctttaagattgattgatctt
tctggatgtgaaaatattacagataaaactatagaaagtatagtcaatttagcccctaaa
ttacgtaatgtttttctaggcaagtgtagccgaattacagatgcatcgttgttccaatta
tcgaagctgggcaaaaacttgcaaacagtgcattttgggcactgtttcaatataactgat
aacggggtaagagcactctttcattcatgtacaagaatacagtatgtggactttgcgtgc
tgtacgaatttaaccaatagaactctttatgaactagcagacttaccaaaattaaagaga
attggccttgtcaaatgtacgcaaatgactgacgagggtttgttgaatatggtttccttg
cgaggccgaaatgatactttagaaagggtacatttatcttactgttctaatttaacaata
tatccgatatatgagcttctaatgtcttgcccaaggctctcacatttgtctttgactgct
gttccgtcatttttacgccccgatataacgatgtattgcaggcctgcaccctcagacttt
agtgaaaatcaacgtcaaatattctgcgtattttcagggaaaggtgttcataaacttcgc
cattatttagtaaatttaacgtcgcccgcttttggaccacatgtcgatgtaaatgatgtt
ttgacaaaatatattagatccaagaatttgatatttaacggtgaaacacttgaagatgct
cttaggagaatcataactgatttaaatcaagattccgctgcaattatagctgctacagga
ttaaatcaaatcaacggtctaaataacgattttcttttccagaatatcaattttgaacga
atagatgaagtattcagttggtatctcaatacttttgatggcattaggatgagctcggag
gaagttaactcactattattgcaagtaaacaagacgttttgtgaagatccatttagtgat
gtggacgatgatcaagattatgtcgtagcacctggtgtaaaccgggaaattaacagtgaa
atgtgtcatattgttagaaaattccatgagttaaatgatcatattgatgatttcgaggtg
aatgttgctagtttggtaagagttcagtttcagtttactggttttttacttcatgaaatg
actcaaacctatatgcaaatgattgaattaaacagacaaatttgtttagtacaaaaaacg
gttcaggaatcgggcaacatagattaccaaaaagggcttttaatatggcgacttttattc
attgacaaattcattatggtggttcagaagtacaagctctccaccgttgttttgagacta
tatttaaaagataacataacattgttaaccagacaaagagaactattaatagcccaccaa
agatcagcatggaataacaataatgacaatgacgccaaccggaacgccaacaacatagtg
aatattgtatcggatgctggggcaaacgatacaagtaacaatgaaactaacaatggtaat
gatgacaatgaaacagaaaatccaaatttctggcgtcagtttggcaatagaatgcaaata
tcacctgaccagatgaggaatctccaaatgggacttcgtaatcagaacatggttaggaac
aataacaacaacacaattgacgaatcaatgcctgacactgccattgattctcaaatggat
gaagcatcaggaacgcccgatgaagatatgttataa

DBGET integrated database retrieval system