KEGG   Saccharomyces cerevisiae (budding yeast): YJR099WHelp
Entry
YJR099W           CDS       T00005                                 

Gene name
YUH1
Definition
Yuh1p (EC:3.4.19.12)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Enzymes [BR:sce01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     YJR099W (YUH1)
Peptidases [BR:sce01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   YJR099W (YUH1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
X:615576..616286
Genome map
AA seq 236 aa AA seqDB search
MSGENRAVVPIESNPEVFTNFAHKLGLKNEWAYFDIYSLTEPELLAFLPRPVKAIVLLFP
INEDRKSSTSQQITSSYDVIWFKQSVKNACGLYAILHSLSNNQSLLEPGSDLDNFLKSQS
DTSSSKNRFDDVTTDQFVLNVIKENVQTFSTGQSEAPEATADTNLHYITYVEENGGIFEL
DGRNLSGPLYLGKSDPTATDLIEQELVRVRVASYMENANEEDVLNFAMLGLGPNWE
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgagcggagaaaatcgtgctgtggtgccgattgaatcaaaccctgaagtttttacaaat
tttgcacataaattaggtttaaaaaatgaatgggcgtatttcgatatctatagcttaaca
gagccagagttactagcattcttaccaaggccagtgaaggccattgtgctgctatttccg
ataaacgaggatagaaaatcgagtaccagtcaacaaattacaagttcttatgatgttata
tggtttaagcaatcagtcaaaaatgcgtgcggattgtatgcaattcttcattctttgagc
aataaccagtcattgttggagcccggctccgacttggacaattttttaaaatctcaaagt
gatacttcaagctcgaagaataggtttgatgatgttactaccgaccaattcgtcttgaat
gtaataaaagagaatgtacaaacattttctactggccagtcagaagcaccagaagcaact
gcagatactaatctacactatatcacatatgtggaagagaacggagggatatttgaactg
gatggaaggaatttgagcggacccctctatttgggaaagagtgacccaactgccaccgat
ttgattgaacaggaattagttagagtgagagtcgcctcatatatggaaaatgcaaatgaa
gaagatgtattaaactttgctatgctaggattgggccctaattgggaataa

DBGET integrated database retrieval system