KEGG   Saccharomyces cerevisiae (budding yeast): YJR143CHelp
Entry
YJR143C           CDS       T00005                                 

Gene name
PMT4
Definition
Pmt4p (EC:2.4.1.109)
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:sce00514]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
X:complement(698326..700614)
Genome map
AA seq 762 aa AA seqDB search
MSVPKKRNHGKLPPSTKDVDDPSLKYTKAAPKCEQVAEHWLLQPLPEPESRYSFWVTIVT
LLAFAARFYKIWYPKEVVFDEVHFGKFASYYLERSYFFDVHPPFAKMMIAFIGWLCGYDG
SFKFDEIGYSYETHPAPYIAYRSFNAILGTLTVPIMFNTLKELNFRAITCAFASLLVAID
TAHVTETRLILLDAILIISIAATMYCYVRFYKCQLRQPFTWSWYIWLHATGLSLSFVIST
KYVGVMTYSAIGFAAVVNLWQLLDIKAGLSLRQFMRHFSKRLNGLVLIPFVIYLFWFWVH
FTVLNTSGPGDAFMSAEFQETLKDSPLSVDSKTVNYFDIITIKHQDTDAFLHSHLARYPQ
RYEDGRISSAGQQVTGYTHPDFNNQWEVLPPHGSDVGKGQAVLLNQHIRLRHVATDTYLL
AHDVASPFYPTNEEITTVTLEEGDGELYPETLFAFQPLKKSDEGHVLKSKTVSFRLFHVD
TSVALWTHNDELLPDWGFQQQEINGNKKVIDPSNNWVVDEIVNLDEVRKVYIPKVVKPLP
FLKKWIETQKSMFEHNNKLSSEHPFASEPYSWPGSLSGVSFWTNGDEKKQIYFIGNIIGW
WFQVISLAVFVGIIVADLITRHRGYYALNKMTREKLYGPLMFFFVSWCCHYFPFFLMARQ
KFLHHYLPAHLIACLFSGALWEVIFSDCKSLDLEKDEDISGASYERNPKVYVKPYTVFLV
CVSCAVAWFFVYFSPLVYGDVSLSPSEVVSREWFDIELNFSK
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgcccaaaaaacgtaaccatgggaagttaccaccttccactaaggacgtagac
gatccttcgttgaagtacacgaaggccgcgcctaaatgtgaacaagttgctgaacattgg
ctcttgcagccactaccggaaccggaatcacgttatagcttttgggtaacaattgttacc
ttattagcgtttgctgctagattttataagatctggtatccaaaagaagttgtttttgat
gaggtacatttcgggaaatttgcatcgtattacttagaaaggtcttatttctttgacgtt
catcccccttttgctaagatgatgattgccttcattggttggttatgtggctatgatggt
tcctttaagtttgatgagattgggtattcttatgaaactcatccagctccatatatcgcg
taccgttctttcaacgcgatattgggcacattgactgtaccaattatgttcaacactttg
aaggaactgaatttcagggctattacatgtgcgtttgcatctctcttggttgcaatcgat
actgcgcatgttacagaaactaggctgattttactggatgccatcttgattatttctatt
gctgctactatgtattgttacgttcgtttctacaagtgccaattgcgtcaaccttttaca
tggagttggtatatttggttacacgctactggtttgtctttatccttcgtgatttccaca
aaatatgttggtgttatgacatattccgctattggttttgctgctgtggtcaacttatgg
caattactggacatcaaggcgggtttgtccttgaggcagttcatgagacattttagtaaa
aggctgaatggtttagttttgattccatttgtgatttacttgttttggttctgggttcat
ttcaccgttttgaatacttcaggtcctggcgacgcatttatgtctgctgaatttcaagaa
acacttaaggactctcccttaagtgttgactctaaaaccgtcaattattttgatattatc
actatcaaacatcaagatactgacgcattcttacattctcacttggcacgttacccacaa
cggtatgaagatggtcgtatctcatccgctggtcaacaagttactggttacacgcatcct
gacttcaacaatcaatgggaagtgttaccaccccatggcagtgatgtcggtaaaggacaa
gctgttctattgaaccagcatataagattgagacatgtagccaccgatacctacttgtta
gcccatgatgtcgcctccccattttaccctaccaatgaagaaatcactacagtaacttta
gaagaaggtgatggggaattatatcctgaaacactttttgcattccaaccactgaaaaaa
tcagatgaaggtcacgttttaaagagtaaaacggtttctttccgtcttttccacgttgat
acctccgtagctttgtggactcacaacgacgagttgttaccggattgggggttccaacaa
caagaaattaatggtaacaaaaaagttattgatccttcaaataactgggttgttgatgaa
attgttaacctggacgaggttcggaaggtatatattccgaaggttgttaagccattacca
ttcttgaagaaatggattgaaactcaaaaatctatgttcgaacataacaataaactatca
tcagagcatccatttgcctctgaaccttacagttggcccggtagtttaagtggtgtttcg
ttctggaccaacggtgacgaaaagaagcaaatatatttcattggtaacatcattgggtgg
tggttccaagtcatatcattggctgtttttgttggcattatcgtggccgatttaattact
agacatcgtggctattatgccctaaacaagatgaccagagaaaagctgtatggcccattg
atgtttttcttcgtctcctggtgctgtcattattttccattctttttaatggcgcgtcaa
aagtttttgcatcattacttaccagctcatttaatcgcgtgcttattctcaggagcacta
tgggaagtaattttcagtgattgcaaatcattggatttggagaaagacgaggatatttca
ggtgcatcatatgaacggaaccctaaggtctacgttaaaccctataccgtcttcttggtg
tgtgtctcctgtgctgttgcgtggttttttgtatacttttcaccactagtgtatggagat
gtcagcttgtcaccatcggaagttgtttctagagagtggtttgacatagaattaaatttc
tccaagtaa

DBGET integrated database retrieval system