KEGG   Saccharomyces cerevisiae (budding yeast): YKL008CHelp
Entry
YKL008C           CDS       T00005                                 

Gene name
LAC1, DGT1
Definition
sphingosine N-acyltransferase LAC1 (EC:2.3.1.24)
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    YKL008C (LAC1)
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     YKL008C (LAC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XI:complement(427295..428551)
Genome map
AA seq 418 aa AA seqDB search
MSTIKPSPSNNNLKVRSRPRRKSSIGKIDLGDTVPSLGTMFETKESKTAAKRRMQRLSEA
TKNDSDLVKKIWFSFREISYRHAWIAPLMILIAVYSAYFTSGNTTKTNVLHRFVAVSYQI
GDTNAYGKGINDLCFVFYYMIFFTFLREFLMDVVIRPFAIRLHVTSKHRIKRIMEQMYAI
FYTGVSGPFGIYCMYHSDLWFFNTKAMYRTYPDFTNPFLFKVFYLGQAAFWAQQACILVL
QLEKPRKDHNELTFHHIVTLLLIWSSYVFHFTKMGLPIYITMDVSDFLLSFSKTLNYLDS
GLAFFSFAIFVVAWIYLRHYINLKILWSVLTQFRTEGNYVLNFATQQYKCWISLPIVFVL
IGALQLVNLYWLFLIFRVLYRILWRGILKDDRSDSESDEESDESSTTPTDSTPTKKDI
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacaataaagccaagcccttcaaacaacaatttgaaagtgaggtcaagaccaaga
cgcaagtcttccataggtaagatcgacctcggggacactgtacctagtttaggtactatg
ttcgagacaaaagaatctaaaacggctgctaaaaggcgtatgcagagattatctgaagcc
accaaaaatgatagcgacctggtcaagaaaatctggttttcattccgagagataagttac
cgtcatgcctggatagctcccttgatgattttaatcgcggtatatagtgcctatttcact
tctggtaacactacaaagacaaatgtgttacatagatttgtcgctgtgtcataccaaata
ggtgataccaacgcatatggtaaaggtattaacgatttgtgctttgtattttactatatg
atttttttcacattcttacgtgaattcctaatggatgttgtcattagaccgttcgctatt
aggttacacgtcacttctaagcacagaataaaaagaatcatggaacaaatgtacgctatt
ttctacaccggtgtttccggtcctttcgggatatattgtatgtaccattcggatttatgg
tttttcaacacaaaggcaatgtacagaacatatccagatttcactaatcccttcttattc
aaggtattctatttgggtcaagctgcattttgggctcaacaagcctgcattcttgtattg
caactagaaaagccaagaaaagatcataacgagttgactttccatcatattgttacttta
ctattgatttggtcttcctacgtatttcatttcactaaaatgggactgccaatctatatc
acaatggatgtttctgattttcttttgtcattctccaaaactctaaattatttggactct
ggattggcttttttttcttttgctatctttgttgttgcgtggatttatttgcgtcattac
ataaatttaaagatcctatggtccgttttaacgcaatttcgcacggaaggtaactatgtc
ttgaattttgccactcagcaatataaatgttggatttccttaccaattgtctttgtattg
ataggcgctttgcaattagtgaatctttattggctgttccttatttttagagttctttac
aggattctatggagaggtattctcaaggatgacagaagtgatagtgaatcagacgaagaa
agtgatgaaagttccactactccaactgacagtactccaacgaaaaaggatatttga

DBGET integrated database retrieval system