KEGG   Saccharomyces cerevisiae (budding yeast): YKL022CHelp
Entry
YKL022C           CDS       T00005                                 

Gene name
CDC16
Definition
anaphase promoting complex subunit CDC16
Orthology
K03353  
anaphase-promoting complex subunit 6
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YKL022C (CDC16)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YKL022C (CDC16)
   04113 Meiosis - yeast
    YKL022C (CDC16)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     YKL022C (CDC16)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     YKL022C (CDC16)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XI:complement(394726..397248)
Genome map
AA seq 840 aa AA seqDB search
MKFCLYCCHCYIVICGKATHYYKSSKATSNLKSSNRVLMRNPMSPSEQHSQHNSTLAASP
FVSNVSAARTQQSLPTDAQNDRLQQPWNRTNTATSPYQSLANSPLIQKLQANIMTPHQPS
ANSNSNSNSITGNVVNDNNLLASMSKNSMFGSTIPSTLRKVSLQREYKDSVDGVVRDEDN
DEDVHNNGDAAANANNDRESKLGHNGPLTTTTLTTTTTATQLDVSELSAIERLRLWRFDA
LMQHMYRTAEYIADKVYNISNDPDDAFWLGQVYYNNNQYVRAVELITRNNLDGVNILCRY
LLGLSFVKLQRFDDALDVIGEYNPFSEDPSTTAANTMSNNGNNSNTSQPVTDGGIKMESS
LCFLRGKIYFAQNNFNKARDAFREAILVDIKNFEAFEMLLSKNLLTPQEEWDLFDSLDFK
EFGEDKEIMKNLYKINLSKYINTEDITKSNEILAKDYKLADNVDVVRSKVDICYTQCKFN
ECLELCETVLENDEFNTNILPAYIGCLYELSNKNKLFLLSHRLAETFPKSAITWFSVATY
YMSLDRISEAQKYYSKSSILDPSFAAAWLGFAHTYALEGEQDQALTAYSTASRFFPGMHL
PKLFLGMQFMAMNSLNLAESYFVLAYDICPNDPLVLNEMGVMYFKKNEFVKAKKYLKKAL
EVVKDLDPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLK
TKKLQKAIDHLHKSLYLKPNNSSATALLKNALELNVTLSLDASHPLIDKSNLMSQASKDK
ASLNKKRSSLTYDPVNMAKRLRTQKEIFDQNNKALRKGGHDSKTGSNNADDDFDADMELE
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atgaagttttgtctttattgctgtcattgttatatcgttatttgtggaaaggctacacat
tattacaagtcatcaaaagccacatcaaacttgaaatcgtcaaacagggtacttatgaga
aaccccatgtcgccttcggagcaacattcacaacataattctacattggccgcctcgcca
tttgtttctaacgtatctgcagcaagaacacaacagagtttaccaaccgatgctcagaat
gatcgtttgcagcaaccctggaacagaaccaatacggctacgagtccctaccagtcgtta
gcaaatagccctttaatacagaagttgcaagcgaatattatgactccgcaccagccatct
gctaattctaattctaattccaattccattacgggcaatgttgtgaacgacaataatttg
ttagcttctatgtctaagaatagtatgttcggttctaccataccgtccacattaaggaag
gtgagcttacagcgtgaatataaggattcagttgatggtgtggttcgtgatgaagataat
gatgaggatgttcataacaatggcgatgcagctgcgaatgctaataatgatcgggagagt
aaactagggcataatgggccattgacgacaacaacattaacgacaacaactacagcaact
caactagatgtttctgaattgtcagctatagaaagattgagactttggaggttcgacgca
ttgatgcagcatatgtataggaccgcagaatatattgctgataaagtgtataacatatcc
aatgatcctgatgatgccttctggctcggccaagtatattacaataataatcagtacgta
agggctgtagaacttattaccaggaacaacttggatggcgttaatatcctgtgtcgatat
ctgttgggactctcctttgttaaattacagagatttgatgacgctctagatgttataggc
gaatacaatccattcagcgaggacccatctacgacggcagcaaacaccatgagcaataat
ggcaataacagcaatacgtcacagccagttactgacggcggtataaaaatggagtcatca
ttatgttttctgagagggaaaatatattttgcacaaaataattttaacaaggcaagggat
gcatttcgtgaagcgattttggtagatataaaaaattttgaagctttcgaaatgctcctg
tccaagaacctgttaactccacaagaggaatgggacctgtttgactctttggatttcaaa
gaatttggggaagataaagagattatgaagaatctttataagatcaacctatctaaatac
atcaacacggaagatataacgaagtccaatgagattttagcgaaagattataaattagct
gacaatgtagatgtcgtaagaagtaaggtggatatctgctatacgcaatgcaaattcaac
gaatgcttagagttgtgcgagaccgttttggaaaacgacgaatttaatacgaatatcttg
ccagcatacattggatgtctatatgaactatcaaataaaaataagcttttccttctgtcg
catcgattagcggaaactttcccgaagtctgcgataacatggtttagcgttgcgacctat
tatatgagcttggacagaattagtgaagcacagaaatactattccaaatcctcaatactg
gatccaagctttgctgccgcatggctgggatttgcacacacgtatgccctagaaggtgaa
caagaccaagcattaacagcatactctacagcctccagattctttcctggaatgcactta
ccaaaactgtttctcgggatgcagtttatggcgatgaattcattaaatttagcagaatcg
tattttgttctggcatatgacatttgtccaaacgatccattagtactcaatgaaatgggt
gtaatgtattttaagaagaacgaatttgtcaaagccaagaaatacctgaagaaggcgttg
gaagtggtgaaagatcttgatccaagttcaagaacgacaatatcaattcaattaaatcta
ggacacacttacagaaagttaaatgagaacgaaattgccattaaatgttttagatgcgtt
ttggagaaaaatgataaaaactctgaaattcattgttccttaggttacttatatttgaag
acgaagaaattacaaaaggccattgatcatttgcacaaatcattgtacctaaagcctaat
aattcatctgcaacagcgcttttgaaaaatgccctagagctaaacgtgacgttatcattg
gatgccagccacccacttattgacaagtcgaatttaatgagtcaggcaagtaaggacaag
gcttcgctcaataaaaaaagatcttcattgacttatgaccctgtcaacatggctaaaagg
ttgagaacacaaaaggagatctttgatcagaataacaaagctctaagaaagggaggtcat
gacagcaaaactggaagtaataatgccgacgatgattttgacgcagatatggaactggaa
taa

DBGET integrated database retrieval system