KEGG   Saccharomyces cerevisiae (budding yeast): YKL026CHelp
Entry
YKL026C           CDS       T00005                                 

Gene name
GPX1
Definition
glutathione peroxidase GPX1 (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:sce00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:sce00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XI:complement(389380..389883)
Genome map
AA seq 167 aa AA seqDB search
MQEFYSFSPIDENGNPFPFNSLRNKVVLIVNVASHCAFTPQYKELEYLYEKYKSHGLVIV
AFPCGQFGNQEFEKDKEINKFCQDKYGVTFPILHKIRCNGQKQDPVYKFLKNSVSGKSGI
KMIKWNFEKFVVDRNGKVVKRFSCMTRPLELCPIIEELLNQPPEEQI
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaattttattctttttcaccaatagatgaaaacggaaatccattccccttcaac
tccctgcgtaacaaagtggttttgatagtcaatgtagcatctcattgtgcgttcacacct
caatacaaggaattagagtacttgtacgaaaaatacaaatcacatggtctagtgattgtg
gcctttccctgtggtcaattcggaaatcaagagttcgagaaggataaagagattaataag
ttctgtcaagataaatatggtgtaaccttccctattctacataagatccgttgcaacggg
caaaagcaagatcccgtctacaagttcttaaagaattcagtaagcgggaagtctggaata
aaaatgataaaatggaattttgaaaagtttgtggtagaccgaaatgggaaggtggttaaa
aggttttcatgcatgactaggccactagagctttgtccaataatcgaagaattactgaat
caaccaccagaagaacagatttaa

DBGET integrated database retrieval system